EY755898

Overview
NameEY755898
Unique NameEY755898
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length904
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig361 contig Csv1_Contig361:69..972. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY755898 vs. ExPASy Swiss-Prot
Match: FKB70_ARATH (70 kDa peptidyl-prolyl isomerase OS=Arabidopsis thaliana GN=ROF1 PE=1 SV=2)

HSP 1 Score: 324.324 bits (830), Expect = 5.836e-88
Identity = 160/209 (76.56%), Postives = 185/209 (88.52%), Query Frame = 2
Query:   32 QNEVALLTIAPEYAFGSADSQQELAVVPPNSTVHYEVELVSFEKEKESWDMNTXXXXXXXXXXXXQGNTLFKAGKYARAS*RYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMS 658
            + EVAL+TI PEYAFGS +SQQELAVVPPNSTV YEV+L++F+KE+ESWDMNT            +GN+ FK GKY+ AS RYEKAVK+IEYDTSF +EEKKQAKALKVACNLN+AACKLKLKDYKQAEKLCTKVL+L+S NVKALYRRAQAY++++DLDLAEFD+KKALEIDP+NR+VKLE K LKEKMKE+NKKEAKFYGNMFAK+S
Sbjct:  341 KGEVALVTIDPEYAFGSNESQQELAVVPPNSTVTYEVDLLTFDKERESWDMNTEEKIEAASKKKEEGNSKFKGGKYSLASKRYEKAVKFIEYDTSFSEEEKKQAKALKVACNLNDAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYMELSDLDLAEFDVKKALEIDPNNREVKLEQKRLKEKMKEFNKKEAKFYGNMFAKLS 549          
BLAST of EY755898 vs. ExPASy Swiss-Prot
Match: FKB70_WHEAT (70 kDa peptidyl-prolyl isomerase OS=Triticum aestivum GN=FKBP70 PE=2 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 2.076e-85
Identity = 160/219 (73.06%), Postives = 185/219 (84.47%), Query Frame = 2
Query:   32 QNEVALLTIAPEYAFGSADSQQELAVVPPNSTVHYEVELVSFEKEKESWDMNTXXXXXXXXXXXXQGNTLFKAGKYARAS*RYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMSMFGSAESNKA 688
            + EVAL+TI PEYA+GS +S+Q+ A+VPPNSTV YEVELVSF K+KESWD+N             +GN LFK+GKYARAS RYEKA K+IEYDTSF ++EKKQ+K LK+ CNLNNAACKLKLKDYKQAEKLCTKVL+LDSRNVKALYRRAQAY Q+ADL+LAE DIKKALEIDP+NRDVKL YKTLKEK+KE NKK+AKFY NMF+KM+   SAE +KA
Sbjct:  343 KGEVALVTIPPEYAYGSTESKQD-AIVPPNSTVIYEVELVSFVKDKESWDLNNSEKIEAAGTKKEEGNALFKSGKYARASKRYEKAAKFIEYDTSFSEDEKKQSKQLKITCNLNNAACKLKLKDYKQAEKLCTKVLELDSRNVKALYRRAQAYTQLADLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFSKMTK-PSAEESKA 559          
BLAST of EY755898 vs. ExPASy Swiss-Prot
Match: FKBP4_BOVIN (FK506-binding protein 4 OS=Bos taurus GN=FKBP4 PE=1 SV=4)

HSP 1 Score: 166.392 bits (420), Expect = 2.034e-40
Identity = 81/209 (38.76%), Postives = 133/209 (63.64%), Query Frame = 2
Query:   32 QNEVALLTIAPEYAFGSADSQQELAVVPPNSTVHYEVELVSFEKEKESWDMNTXXXXXXXXXXXXQGNTLFKAGKYARAS*RYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMS 658
            + E +++ + P YAFGSA   +E   +PPN+ + YE+ L SFEK KESW+M++            +G   FK GKY +A  +Y+K V ++EY++SF DE+ ++A+AL++A +LN A C LKL+ +  A + C K L+LDS N K L+RR +A++ + D DLA  D +K L++ P N+  K +    ++++++  +KE K Y NMF +++
Sbjct:  213 KGEHSIVYLKPRYAFGSAG--KEKFQIPPNAELKYEIHLKSFEKAKESWEMSSEEKLEQSTIVKERGTVYFKEGKYKQAVLQYKKIVSWLEYESSFSDEDAEKAQALRLASHLNLAMCHLKLQAFSAAIENCNKALELDSNNEKGLFRRGEAHLAVNDFDLARADFQKVLQLYPSNKAAKAQLVVCQQRIRKQLEKEKKLYANMFERLA 419          
BLAST of EY755898 vs. ExPASy Swiss-Prot
Match: FKBP4_RABIT (FK506-binding protein 4 OS=Oryctolagus cuniculus GN=FKBP4 PE=1 SV=3)

HSP 1 Score: 165.622 bits (418), Expect = 3.469e-40
Identity = 88/235 (37.45%), Postives = 141/235 (60.00%), Query Frame = 2
Query:   32 QNEVALLTIAPEYAFGSADSQQELAVVPPNSTVHYEVELVSFEKEKESWDMNTXXXXXXXXXXXXQGNTLFKAGKYARAS*RYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMSMFGSAESNKAEPKEA---EPMSVDSK 727
            + E ++L + P YAFG+A   +E   +PP + + YEV L SFEK KESW+M++            +G   FK GKY +A  +Y+K V ++EY++SF  EE ++A+AL++A +LN A C LKL+ +  A + C K L+LDS N K L+RR +A++ + D DLA  D +K L++ P N+  K +    ++++++   +E K Y NMF ++    + E NKA+ + A    PM  + K
Sbjct:  213 KGEHSILYLKPSYAFGNAG--KEKFQIPPYAELKYEVHLKSFEKAKESWEMSSEEKLEQSAIVKERGTVYFKEGKYKQALLQYKKIVSWLEYESSFSSEEVQKAQALRLASHLNLAMCHLKLQAFSAAVESCNKALELDSNNEKGLFRRGEAHLAVNDFDLARADFQKVLQLYPSNKAAKAQLAVCQQRIRKQIAREKKLYANMFERL----AEEENKAKAEVAAGDHPMDTEMK 441          
BLAST of EY755898 vs. ExPASy Swiss-Prot
Match: FKBP4_HUMAN (FK506-binding protein 4 OS=Homo sapiens GN=FKBP4 PE=1 SV=3)

HSP 1 Score: 164.466 bits (415), Expect = 7.729e-40
Identity = 83/220 (37.73%), Postives = 136/220 (61.82%), Query Frame = 2
Query:   32 QNEVALLTIAPEYAFGSADSQQELAVVPPNSTVHYEVELVSFEKEKESWDMNTXXXXXXXXXXXXQGNTLFKAGKYARAS*RYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMSMFGSAESNKAE 691
            + E +++ + P YAFGS    +E   +PPN+ + YE+ L SFEK KESW+MN+            +G   FK GKY +A  +Y+K V ++EY++SF +EE ++A+AL++A +LN A C LKL+ +  A + C K L+LDS N K L+RR +A++ + D +LA  D +K L++ P+N+  K +    +++++    +E K Y NMF ++    + E NKA+
Sbjct:  213 KGEHSIVYLKPSYAFGSVG--KEKFQIPPNAELKYELHLKSFEKAKESWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWLEYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERL----AEEENKAK 426          
BLAST of EY755898 vs. ExPASy Swiss-Prot
Match: FKBP4_RAT (FK506-binding protein 4 OS=Rattus norvegicus GN=Fkbp4 PE=1 SV=3)

HSP 1 Score: 157.918 bits (398), Expect = 7.234e-38
Identity = 82/224 (36.61%), Postives = 132/224 (58.93%), Query Frame = 2
Query:   32 QNEVALLTIAPEYAFGSADSQQELAVVPPNSTVHYEVELVSFEKEKESWDMNTXXXXXXXXXXXXQGNTLFKAGKYARAS*RYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMSMFGSAESNKAEPKEA 703
            + E +++ + P YAFGS    +E   +PP++ + YEV L SFEK K SW+MN+            +G   FK GKY +A  +Y+K V ++EY++SF  EE ++  AL++A +LN A C LKL+ +  A + C K L+LDS N K L+RR +A++ + D DLA  D +K L++ P N+  K +    +++ +    +E K Y NMF ++    + E +KA+ + A
Sbjct:  213 KGEHSIVYLKPSYAFGSVG--KERFQIPPHAELRYEVHLKSFEKAKASWEMNSEEKLEQSNIVKERGTVYFKEGKYKQALLQYKKIVSWLEYESSFSGEEMQKVHALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFDLARADFQKVLQLYPSNKAAKTQLAVCQQRTRRQLAREKKLYANMFERL----AEEEHKAKTEVA 430          
BLAST of EY755898 vs. ExPASy Swiss-Prot
Match: FKBP4_MOUSE (FK506-binding protein 4 OS=Mus musculus GN=Fkbp4 PE=1 SV=5)

HSP 1 Score: 157.532 bits (397), Expect = 9.448e-38
Identity = 78/209 (37.32%), Postives = 126/209 (60.29%), Query Frame = 2
Query:   32 QNEVALLTIAPEYAFGSADSQQELAVVPPNSTVHYEVELVSFEKEKESWDMNTXXXXXXXXXXXXQGNTLFKAGKYARAS*RYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMS 658
            + E +++ + P YAFGS    +E   +PP++ + YEV L SFEK KESW+M++            +G   FK GKY +A  +Y+K V ++EY++SF  EE ++  AL++A +LN A C LKL+ +  A + C K L+LDS N K L+RR +A++ + D DLA  D +K L++ P N+  K +    +++ +    +E K Y NMF +++
Sbjct:  213 KGEHSIVYLKPSYAFGSVG--KERFQIPPHAELRYEVRLKSFEKAKESWEMSSAEKLEQSNIVKERGTAYFKEGKYKQALLQYKKIVSWLEYESSFSGEEMQKVHALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFDLARADFQKVLQLYPSNKAAKTQLAVCQQRTRRQLAREKKLYANMFERLA 419          
BLAST of EY755898 vs. ExPASy Swiss-Prot
Match: FKBP5_CERAE (FK506-binding protein 5 OS=Cercopithecus aethiops GN=FKBP5 PE=2 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 2.749e-37
Identity = 83/224 (37.05%), Postives = 128/224 (57.14%), Query Frame = 2
Query:   32 QNEVALLTIAPEYAFGSADSQQELAVVPPNSTVHYEVELVSFEKEKESWDMNTXXXXXXXXXXXXQGNTLFKAGKYARAS*RYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMS-MFGSAESNKAEPKE 700
            + E  +L + P Y FG A   +    + PN+ + YEV L SFEK KESW+M+T            +G   FK GKY RA  +Y K V ++E +    ++E K +++  +A  LN A C LKL++Y +A + C K L LDS N K LYRR +A + M + + A+ D +K LE++P N+  +L+    ++K KE+N+++ + Y NMF K +      E+NKA  K+
Sbjct:  211 REEQCILYLGPRYGFGEAGKPK--FGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMRAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKK 432          
BLAST of EY755898 vs. ExPASy Swiss-Prot
Match: FKBP5_MOUSE (FK506-binding protein 5 OS=Mus musculus GN=Fkbp5 PE=1 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 3.590e-37
Identity = 83/225 (36.89%), Postives = 127/225 (56.44%), Query Frame = 2
Query:   32 QNEVALLTIAPEYAFGSADSQQELAVVPPNSTVHYEVELVSFEKEKESWDMNTXXXXXXXXXXXXQGNTLFKAGKYARAS*RYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMS-MFGSAESNKAEPKEA 703
            + E  +L + P Y FG A   +    + PN+ + YEV L SFEK KESW+M+T            +G   FK GKY +A  +Y K V ++E +    ++E K +++  +A  LN A C LKL++Y +A + C K L LDS N K LYRR +A + M D + A+ D +K L ++P NR  +L+    + K KE+N+++ + Y NMF K +      E++KA  K+A
Sbjct:  211 REEQCILYLGPRYGFGEAGKPK--FGIDPNAELMYEVTLKSFEKAKESWEMDTKEKLTQAAIVKEKGTVYFKGGKYTQAVIQYRKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYNKAVECCDKALGLDSANEKGLYRRGEAQLLMNDFESAKGDFEKVLAVNPQNRAARLQISMCQRKAKEHNERDRRVYANMFKKFAERDAKEEASKAGSKKA 433          
BLAST of EY755898 vs. ExPASy Swiss-Prot
Match: FKBP5_SAGOE (FK506-binding protein 5 OS=Saguinus oedipus GN=FKBP5 PE=2 SV=2)

HSP 1 Score: 155.221 bits (391), Expect = 4.689e-37
Identity = 82/224 (36.61%), Postives = 128/224 (57.14%), Query Frame = 2
Query:   32 QNEVALLTIAPEYAFGSADSQQELAVVPPNSTVHYEVELVSFEKEKESWDMNTXXXXXXXXXXXXQGNTLFKAGKYARAS*RYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMS-MFGSAESNKAEPKE 700
            + E  +L + P Y FG A   +    + PN+ + YEV L SFEK KESW+M+T            +G   FK GKY +A  +Y K V ++E +    ++E K +++  +A  LN A C LKL++Y +A + C K L LDS N K LYRR +A + M + + A+ D +K LE++P N+  +L+    ++K KE+N+++ + Y NMF K +      E+NKA  K+
Sbjct:  211 REEQCILHLGPRYGFGEAGKPK--FGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEEGTVYFKGGKYVQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYAKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQIVVCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAVSKK 432          
The following BLAST results are available for this feature:
BLAST of EY755898 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
FKB70_ARATH5.836e-8876.5670 kDa peptidyl-prolyl isomerase OS=Arabidopsis th... [more]
FKB70_WHEAT2.076e-8573.0670 kDa peptidyl-prolyl isomerase OS=Triticum aesti... [more]
FKBP4_BOVIN2.034e-4038.76FK506-binding protein 4 OS=Bos taurus GN=FKBP4 PE=... [more]
FKBP4_RABIT3.469e-4037.45FK506-binding protein 4 OS=Oryctolagus cuniculus G... [more]
FKBP4_HUMAN7.729e-4037.73FK506-binding protein 4 OS=Homo sapiens GN=FKBP4 P... [more]
FKBP4_RAT7.234e-3836.61FK506-binding protein 4 OS=Rattus norvegicus GN=Fk... [more]
FKBP4_MOUSE9.448e-3837.32FK506-binding protein 4 OS=Mus musculus GN=Fkbp4 P... [more]
FKBP5_CERAE2.749e-3737.05FK506-binding protein 5 OS=Cercopithecus aethiops ... [more]
FKBP5_MOUSE3.590e-3736.89FK506-binding protein 5 OS=Mus musculus GN=Fkbp5 P... [more]
FKBP5_SAGOE4.689e-3736.61FK506-binding protein 5 OS=Saguinus oedipus GN=FKB... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Properties
Property NameValue
Genbank descriptionCS13-C1-001-001-B08-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY755898 ID=EY755898|Name=EY755898|organism=Citrus sinensis|type=EST|length=904bp
TTTCGGTCGACCCCGCGTCCGATTACATGTACAAAATGAGGTTGCACTGC
TGACAATAGCACCAGAGTATGCTTTTGGCTCGGCTGACTCGCAGCAGGAG
CTGGCTGTAGTACCTCCTAATTCAACTGTGCATTATGAGGTTGAGCTGGT
GTCCTTTGAAAAGGAGAAGGAATCGTGGGACATGAATACTGAGGAAAAGA
TTGAAGCCGCTGGGAAGAAGAAGGAACAAGGAAATACATTGTTTAAGGCA
GGCAAATATGCAAGAGCCTCATAGAGATATGAGAAAGCTGTCAAGTACAT
CGAGTACGATACTTCCTTTGGTGACGAAGAGAAAAAACAGGCAAAGGCAT
TGAAAGTTGCTTGCAATCTCAATAATGCTGCTTGCAAATTGAAACTCAAG
GATTACAAGCAGGCAGAAAAATTATGCACCAAGGTGCTTGACTTGGATAG
TAGAAATGTGAAAGCTCTGTACAGAAGGGCTCAGGCATACATTCAGATGG
CAGATTTAGATTTGGCAGAGTTTGATATCAAGAAAGCACTTGAGATTGAT
CCTGATAACAGGGATGTCAAGTTGGAGTACAAAACTTTGAAGGAGAAGAT
GAAGGAATACAACAAAAAAGAGGCTAAGTTTTATGGCAACATGTTTGCGA
AGATGAGTATGTTTGGATCTGCTGAATCCAATAAAGCAGAGCCCAAGGAG
GCAGAGCCCATGAGCGTAGACAGCAAGGCATGACTGAAGTATAATCAATT
TGATTGTTAGATATATATTAATTGCTGGATTTTGTGTTCCAATTCCATGG
ACTGTANGACTTGCTGGGTCGTTTGCCTTACAGAATGAGCAGTTGTAATG
GACCTTTCTTTTATTTGAGTACTTTTCTTGATGAACGATGACATATAAGA
ACTT
back to top