EY755882

Overview
NameEY755882
Unique NameEY755882
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length929
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY755882_ssr76 microsatellite EY755882_ssr76:76..87. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY755882 vs. ExPASy Swiss-Prot
Match: UAF30_SCHPO (Upstream activation factor subunit spp27 OS=Schizosaccharomyces pombe GN=spp27 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 9.501e-17
Identity = 47/102 (46.08%), Postives = 70/102 (68.63%), Query Frame = 2
Query:  368 KGPAKR-RSRKLNNEV---KKRG-----GGFSKLCALSPQLQEFIGVTELARTEVVKQLWAYIREKDLXDPNNRRNIVCDERLRALFGVDTINMFSMNKALS 646
            K PAKR R RK + E    +KR         +K   LSP+L EF+G+ +L+R + VK+LW YI+  DL DPN++R I+CD++L+++F VDT++MF+MNK L+
Sbjct:   87 KKPAKRTRKRKEDGEEGGKRKRNQDPANNPLNKPMKLSPKLAEFLGLEQLSRPQTVKKLWEYIKAHDLQDPNDKRTILCDDKLKSVFEVDTLHMFTMNKYLT 188          
BLAST of EY755882 vs. ExPASy Swiss-Prot
Match: TRI1_YEAST (Protein TRI1 OS=Saccharomyces cerevisiae GN=TRI1 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.792e-15
Identity = 41/97 (42.27%), Postives = 61/97 (62.89%), Query Frame = 2
Query:  368 KGPAKRRSRKLNNEVKKRGGGFSKLCALSPQLQEFIGVTELARTEVVKQLWAYIREKDLXDPNNRRNIVCDERLRALFGVDTINMFSMNKALSKHIW 658
            K  +K + +K  N+         +   LS  LQ+F+G  EL RT+VVK +W YI+E DL +P +RR I+CDE++  +FG   + MFSMNK L+KH++
Sbjct:   99 KSESKSKRKKKKNDSPDSNSISVRKVLLSAPLQKFLGSEELPRTQVVKMIWQYIKEHDLQNPKDRREILCDEKMEPIFG-KKMTMFSMNKLLTKHLF 194          
BLAST of EY755882 vs. ExPASy Swiss-Prot
Match: UAF30_YEAST (Upstream activation factor subunit UAF30 OS=Saccharomyces cerevisiae GN=UAF30 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.190e-13
Identity = 42/101 (41.58%), Postives = 58/101 (57.43%), Query Frame = 2
Query:  371 GPAKRRSRKLNNEVKKRGGGFSKL------CALSPQLQEFIGVTELARTEVVKQLWAYIREKDLXDPNNRRNIVCDERLRALFGVDTINMFSMNKALSKHI 655
            G  K  S      V+K+ G  SK         LS  L   +G  EL RTEVV++LWAYI+  +L +PNN++ I+CDE+L  + G  T NMF M+K L+ H+
Sbjct:   94 GEEKNDSETKGTHVEKKKGTVSKSPISTRKVTLSKSLASLLGEHELTRTEVVRRLWAYIKAHNLQNPNNKKEILCDEKLELILGKST-NMFEMHKILASHM 193          
The following BLAST results are available for this feature:
BLAST of EY755882 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
UAF30_SCHPO9.501e-1746.08Upstream activation factor subunit spp27 OS=Schizo... [more]
TRI1_YEAST1.792e-1542.27Protein TRI1 OS=Saccharomyces cerevisiae GN=TRI1 P... [more]
UAF30_YEAST2.190e-1341.58Upstream activation factor subunit UAF30 OS=Saccha... [more]
back to top
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Properties
Property NameValue
Genbank descriptionCS13-C1-001-001-A02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY755882 ID=EY755882|Name=EY755882|organism=Citrus sinensis|type=EST|length=929bp
CCACGCGTCCGAGATGGTATCGCACTCGGAGCTTATCGCCAGACTGCAGG
AGTTCCTCAAAAACTCGGACCTGAACACCACCACCACAGGTATCGTGCGC
CGGCAACTAGAGAAAGATTTTGGAGTTGATTTGACGGATAAGAAAATATT
TATTAGAGAACAGGTTGATTTATTTCTTCAAAGCCAGTTTGAGAATGATC
AAAACGACGGTGGAAACGAAGAACAACAAGAAGAAGATGATGGTGAAGAT
GATCAGATGGCGAAGGTGAAATCTGATGAAACGGATGGTTCTGATGATGC
TGCAGTGGAGGAAGGTGACGATGATAATAATGACGAAAACGACAATGATG
ACGAGGCGAATGAAGCGAAGGGTCCCGCAAAGAGACGGTCTAGAAAGCTT
AATAATGAGGTCAAGAAAAGAGGGGGTGGTTTTAGCAAGTTATGTGCCCT
CTCTCCTCAACTTCAGGAATTCATTGGGGTGACTGAACTGGCCAGGACTG
AGGTTGTCAAGCAACTGTGGGCCTACATTAGAGAGAAGGATTTGNCAGAC
CCAAATAATAGACGAAATATTGTTTGTGATGAACGATTACGTGCCCTTTT
TGGTGTTGATACCATCAACATGTTTTCAATGAATAAGGCCTTATCAAAGC
ATATATGGGCCTTTGGATTCAGATGATNGTATTTCTGTCCAGTCAACACC
AAGGAAAAAACACGAAAGCCAGAGAGAACAGAGGATTTAGATGAGCCGAC
TAGAAAGGAAAGAGACAGAAGGGAGGGAAATCTGGTTTTCCTGCACCTCT
CAACTTTCAGATGCTCTAATCAAGTTCCTGGGACTGGAAAAAGGCATTAC
CAAGCCTGATGGTATTAGAGAATGTGGAATTCCTAAGGGAAAAAACTCCC
GGATCCTCTTGAAAAAAAAATAAATGGGA
back to top