EY755705

Overview
NameEY755705
Unique NameEY755705
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length816
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9921 contig Csv1_Contig9921:12..830. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY755705 vs. ExPASy Swiss-Prot
Match: IF5A_MANES (Eukaryotic translation initiation factor 5A OS=Manihot esculenta PE=2 SV=2)

HSP 1 Score: 318.546 bits (815), Expect = 2.712e-86
Identity = 153/160 (95.62%), Postives = 158/160 (98.75%), Query Frame = 3
Query:   63 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDAPHVTRTDYQLIDISEDGFVSLLTETGNTKDDLRLPTDENLLSQIKDGFAEGKDLVVTVMSSMGEEQICALKDIGPKN 542
            MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKV+EVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCD PHV RTDYQLIDISEDGFVSLLTETGNTKDDLRLPTDENLLSQIKDGFAEGKDLVV+VMS+MGEE+IC+LKDIGPKN
Sbjct:    1 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVMEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTETGNTKDDLRLPTDENLLSQIKDGFAEGKDLVVSVMSAMGEERICSLKDIGPKN 160          
BLAST of EY755705 vs. ExPASy Swiss-Prot
Match: IF5A2_SOLLC (Eukaryotic translation initiation factor 5A-2 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 1.179e-81
Identity = 146/160 (91.25%), Postives = 152/160 (95.00%), Query Frame = 3
Query:   63 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDAPHVTRTDYQLIDISEDGFVSLLTETGNTKDDLRLPTDENLLSQIKDGFAEGKDLVVTVMSSMGEEQICALKDIGPKN 542
            MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIK RPCKVVEVSTSKTGKHGHAKCHFV IDIFNGKKLEDIVPSSHNCD PHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTDENLL Q+KDGF EGKDLVV+VMS+MGEEQI A+KD+G KN
Sbjct:    1 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTDENLLKQVKDGFQEGKDLVVSVMSAMGEEQINAVKDVGTKN 160          
BLAST of EY755705 vs. ExPASy Swiss-Prot
Match: IF5A2_NICPL (Eukaryotic translation initiation factor 5A-2 OS=Nicotiana plumbaginifolia GN=EIF-5A2 PE=2 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.540e-81
Identity = 146/159 (91.82%), Postives = 152/159 (95.60%), Query Frame = 3
Query:   63 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDAPHVTRTDYQLIDISEDGFVSLLTETGNTKDDLRLPTDENLLSQIKDGFAEGKDLVVTVMSSMGEEQICALKDIGPK 539
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHFV IDIF GKKLEDIVPSSHNCD PHV RTDYQLIDISEDGFVSLLTE GNTKDDLRLPTD+NLL+QIKDGFAEGKDLVV+VMS+MGEEQICALKDIGPK
Sbjct:    1 MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDDNLLTQIKDGFAEGKDLVVSVMSAMGEEQICALKDIGPK 159          
BLAST of EY755705 vs. ExPASy Swiss-Prot
Match: IF5A1_TOBAC (Eukaryotic translation initiation factor 5A-1 OS=Nicotiana tabacum GN=EIF-5A1 PE=3 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 3.430e-81
Identity = 143/159 (89.94%), Postives = 152/159 (95.60%), Query Frame = 3
Query:   63 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDAPHVTRTDYQLIDISEDGFVSLLTETGNTKDDLRLPTDENLLSQIKDGFAEGKDLVVTVMSSMGEEQICALKDIGPK 539
            MSDEEHHFESKADAGASKT+PQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHFV IDIF GKKLEDIVPSSHNCD PHV RTDYQLIDISEDGFVSLLTE GNTKDDLRLPTD+NLL+ IKDGFAEGKDLV++VMS+MGEEQIC +KD+GPK
Sbjct:    1 MSDEEHHFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDDNLLALIKDGFAEGKDLVLSVMSAMGEEQICGIKDVGPK 159          
BLAST of EY755705 vs. ExPASy Swiss-Prot
Match: IF5A1_NICPL (Eukaryotic translation initiation factor 5A-1 OS=Nicotiana plumbaginifolia GN=EIF-5A1 PE=2 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 3.430e-81
Identity = 143/159 (89.94%), Postives = 152/159 (95.60%), Query Frame = 3
Query:   63 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDAPHVTRTDYQLIDISEDGFVSLLTETGNTKDDLRLPTDENLLSQIKDGFAEGKDLVVTVMSSMGEEQICALKDIGPK 539
            MSDEEHHFESKADAGASKT+PQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHFV IDIF GKKLEDIVPSSHNCD PHV RTDYQLIDISEDGFVSLLTE GNTKDDLRLPTD+NLL+ IKDGFAEGKDLV++VMS+MGEEQIC +KD+GPK
Sbjct:    1 MSDEEHHFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDDNLLALIKDGFAEGKDLVLSVMSAMGEEQICGIKDVGPK 159          
BLAST of EY755705 vs. ExPASy Swiss-Prot
Match: IF5A3_SOLTU (Eukaryotic translation initiation factor 5A-3 OS=Solanum tuberosum GN=EIF5A3 PE=2 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 5.851e-81
Identity = 145/160 (90.62%), Postives = 152/160 (95.00%), Query Frame = 3
Query:   63 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDAPHVTRTDYQLIDISEDGFVSLLTETGNTKDDLRLPTDENLLSQIKDGFAEGKDLVVTVMSSMGEEQICALKDIGPKN 542
            MSDEEHHFESKADAGASKT+PQQAGTIRKNGYIVIK RPCKVVEVSTSKTGKHGHAKCHFV IDIFNGKKLEDIVPSSHNCD PHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTDE+LL Q+KDGF EGKDLVV+VMS+MGEEQI A+KDIG KN
Sbjct:    1 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTDESLLKQVKDGFQEGKDLVVSVMSAMGEEQINAIKDIGTKN 160          
BLAST of EY755705 vs. ExPASy Swiss-Prot
Match: IF5A5_SOLTU (Eukaryotic translation initiation factor 5A-5 OS=Solanum tuberosum GN=EIF5A5 PE=2 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 9.981e-81
Identity = 142/159 (89.31%), Postives = 152/159 (95.60%), Query Frame = 3
Query:   63 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDAPHVTRTDYQLIDISEDGFVSLLTETGNTKDDLRLPTDENLLSQIKDGFAEGKDLVVTVMSSMGEEQICALKDIGPK 539
            MSDEEHHFESKADAGASKT+PQQAGTIRK+G+IVIKNRPCKVVEVSTSKTGKHGHAKCHFV IDIF GKKLEDIVPSSHNCD PHV RTDYQLIDISEDGFVSLLTE GNTKDDLRLPTD+ LL+Q+KDGFAEGKDLV++VMS+MGEEQIC +KDIGPK
Sbjct:    1 MSDEEHHFESKADAGASKTYPQQAGTIRKSGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDDTLLAQVKDGFAEGKDLVLSVMSAMGEEQICGIKDIGPK 159          
BLAST of EY755705 vs. ExPASy Swiss-Prot
Match: IF5A1_SOLLC (Eukaryotic translation initiation factor 5A-1 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 1.304e-80
Identity = 142/159 (89.31%), Postives = 151/159 (94.97%), Query Frame = 3
Query:   63 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDAPHVTRTDYQLIDISEDGFVSLLTETGNTKDDLRLPTDENLLSQIKDGFAEGKDLVVTVMSSMGEEQICALKDIGPK 539
            MSDEEHHFESKADAGASKT+PQQAGTIRK G+IVIKNRPCKVVEVSTSKTGKHGHAKCHFV IDIF GKKLEDIVPSSHNCD PHV RTDYQLIDISEDGFVSLLTE GNTKDDLRLPTD+ LL+Q+KDGFAEGKDLV++VMS+MGEEQIC +KDIGPK
Sbjct:    1 MSDEEHHFESKADAGASKTYPQQAGTIRKGGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDDTLLAQVKDGFAEGKDLVLSVMSAMGEEQICGIKDIGPK 159          
BLAST of EY755705 vs. ExPASy Swiss-Prot
Match: IF5A2_MEDSA (Eukaryotic translation initiation factor 5A-2 OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 2.223e-80
Identity = 142/159 (89.31%), Postives = 153/159 (96.23%), Query Frame = 3
Query:   63 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDAPHVTRTDYQLIDISEDGFVSLLTETGNTKDDLRLPTDENLLSQIKDGFAEGKDLVVTVMSSMGEEQICALKDIGPK 539
            MSDEEHHFE  ADAGASKT+PQQAGTIRKNGYIVIK+RPCKVVEVSTSKTGKHGHAKCHFV IDIFNGKKLEDIVPSSHNCD PHV RTDYQLIDISEDGFVSLLT+ G+TKDDL+LPTD++LL+QIKDGFA+GKDLVV+VMS+MGEEQICALKDIGPK
Sbjct:    1 MSDEEHHFEPAADAGASKTYPQQAGTIRKNGYIVIKSRPCKVVEVSTSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGSTKDDLKLPTDDSLLTQIKDGFADGKDLVVSVMSAMGEEQICALKDIGPK 159          
BLAST of EY755705 vs. ExPASy Swiss-Prot
Match: IF5A3_SOLLC (Eukaryotic translation initiation factor 5A-3 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 2.904e-80
Identity = 146/159 (91.82%), Postives = 150/159 (94.34%), Query Frame = 3
Query:   63 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDAPHVTRTDYQLIDISEDGFVSLLTETGNTKDDLRLPTDENLLSQIKDGFAEGKDLVVTVMSSMGEEQICALKDIGPK 539
            MSDEEH FESKADAGASKT+PQQAGTIRKNGYIVIK RPCKVVEVSTSKTGKHGHAKCHFV IDIF GKKLEDIVPSSHNCD PHV RTDYQLIDISEDGFVSLLT+ GNTKDDLRLPTDENLLS IKDGFAEGKDLVV+VMS+MGEEQI ALKDIGPK
Sbjct:    1 MSDEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLRLPTDENLLSLIKDGFAEGKDLVVSVMSAMGEEQINALKDIGPK 159          
The following BLAST results are available for this feature:
BLAST of EY755705 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
IF5A_MANES2.712e-8695.63Eukaryotic translation initiation factor 5A OS=Man... [more]
IF5A2_SOLLC1.179e-8191.25Eukaryotic translation initiation factor 5A-2 OS=S... [more]
IF5A2_NICPL1.540e-8191.82Eukaryotic translation initiation factor 5A-2 OS=N... [more]
IF5A1_TOBAC3.430e-8189.94Eukaryotic translation initiation factor 5A-1 OS=N... [more]
IF5A1_NICPL3.430e-8189.94Eukaryotic translation initiation factor 5A-1 OS=N... [more]
IF5A3_SOLTU5.851e-8190.63Eukaryotic translation initiation factor 5A-3 OS=S... [more]
IF5A5_SOLTU9.981e-8189.31Eukaryotic translation initiation factor 5A-5 OS=S... [more]
IF5A1_SOLLC1.304e-8089.31Eukaryotic translation initiation factor 5A-1 OS=S... [more]
IF5A2_MEDSA2.223e-8089.31Eukaryotic translation initiation factor 5A-2 OS=M... [more]
IF5A3_SOLLC2.904e-8091.82Eukaryotic translation initiation factor 5A-3 OS=S... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange leaf, field plant Acdna_library
Properties
Property NameValue
Genbank descriptionCS12-C1-001-031-F04-CT.F Sweet orange leaf, field plant A Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY755705 ID=EY755705|Name=EY755705|organism=Citrus sinensis|type=EST|length=816bp
AATTTATTGACACAAACACAGACAGAAGCAGAAGGAGAACAAGAAGAAGA
AAGAAAAAAACTATGTCGGACGAGGAGCACCACTTCGAATCGAAGGCTGA
TGCCGGTGCATCGAAGACTTTCCCTCAGCAAGCTGGAACCATCCGCAAGA
ATGGTTATATTGTCATCAAAAATCGTCCTTGCAAGGTTGTTGAAGTTTCC
ACTTCAAAGACTGGCAAGCATGGACATGCCAAGTGCCACTTTGTGGGAAT
TGATATATTTAATGGAAAGAAGCTTGAAGATATTGTGCCTTCCTCCCACA
ATTGTGATGCTCCCCATGTTACTCGCACTGACTATCAGCTGATTGATATA
TCCGAAGATGGTTTTGTGAGCCTTTTAACTGAAACCGGAAACACCAAGGA
TGATCTGAGGCTTCCTACCGATGAAAATCTGCTTAGCCAGATTAAAGATG
GGTTTGCTGAAGGAAAAGACCTTGTGGTGACCGTTATGTCGTCAATGGGA
GAGGAGCAGATCTGTGCCCTTAAGGACATTGGTCCTAAGAATTAACTATA
ATCCCATGGCATTAGCTTTGGCTGATAGCAGGAGAACTCTTTCTTATGTT
GCCAACATGGAGACTATCTACTATCCATGTCCACAACAAACTTCCATTAA
GATAGTATTTTGGCTGTGTATTAAAATATCGTCGTGCTTGTGATAAAGGA
AGTGGAAAGAAGCAGGTGTCGTCAATCTCCTGTTGAACGAAATTATGTTG
ACAGCATCTCGGACTTATTATATTTTACTATTTTATTAAAAAAAAAAANN
NNNNAAAANNNNNGGG
back to top