EY728716

Overview
NameEY728716
Unique NameEY728716
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length905
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY728716_ssr48 microsatellite EY728716_ssr48:48..59. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig11804 contig Csv1_Contig11804:2..906. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY728716 vs. ExPASy Swiss-Prot
Match: LEUC_ARATH (3-isopropylmalate dehydratase OS=Arabidopsis thaliana GN=IIL1 PE=2 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 1.589e-85
Identity = 148/203 (72.91%), Postives = 174/203 (85.71%), Query Frame = 3
Query:  165 SSVISPAPTSSFINNKKDLGSFCFSSTSQFSVNKCKKLAVSKKIVSVMAPQQSERRPATTGSVKNAMTLTEKIFARASEKPQLSPGDNVWVNVDILMTHDVCGPGSFGIFKKEFGENAKVWDREKIVIIPDHYIFTSDERANRNVDILRDFCMEQNIKYFYDIKDLGNFKANPDYKGVCHIALAQEGHCRPXEVLLGTDSHTC 773
            +SVIS +P     ++K DLG   F  +SQ S+++C+K ++S+KIVSVMAPQ+ +R P TTGSVK  MT+TEKI ARASEK  + PGDN+WVNVD+LMTHDVCGPG+FGIFK+EFGE AKVWD EKIV+IPDHYIFT+D+RANRNVDI+R+ C EQNIKYFYDI DLGNFKANPDYKGVCH+ALAQEGHCRP EVLLGTDSHTC
Sbjct:    2 ASVISSSPFLCKSSSKSDLGISSFPKSSQISIHRCQKKSISRKIVSVMAPQK-DRSPGTTGSVKTGMTMTEKILARASEKSLVVPGDNIWVNVDVLMTHDVCGPGAFGIFKREFGEKAKVWDPEKIVVIPDHYIFTADKRANRNVDIMREHCREQNIKYFYDITDLGNFKANPDYKGVCHVALAQEGHCRPGEVLLGTDSHTC 203          
BLAST of EY728716 vs. ExPASy Swiss-Prot
Match: LEUC_METJA (Isopropylmalate/citramalate isomerase large subunit OS=Methanocaldococcus jannaschii GN=leuC PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 2.851e-26
Identity = 63/137 (45.99%), Postives = 84/137 (61.31%), Query Frame = 3
Query:  363 MTLTEKIFARASEKPQLSPGDNVWVNVDILMTHDVCGPGSFGIFKKEFGENAKVWDREKIVIIPDHYIFTSDERANRNVDILRDFCMEQNIKYFYDIKDLGNFKANPDYKGVCHIALAQEGHCRPXEVLLGTDSHTC 773
            MT+ EKI A+AS K ++SPGD V  N+D+ M HD+ GP +     KE+G   KVW+ EKIVI+ DH +     +A  N  ++R F  EQ IKYFYDI++           GVCH  L ++GH  P EV++G DSHTC
Sbjct:    3 MTIVEKILAKASGKKEVSPGDIVMANIDVAMVHDITGPLTVNTL-KEYGIE-KVWNPEKIVILFDHQVPADSIKAAENHILMRKFVKEQGIKYFYDIRE-----------GVCHQVLPEKGHVAPGEVVVGADSHTC 126          
BLAST of EY728716 vs. ExPASy Swiss-Prot
Match: LEUC1_METTH (3-isopropylmalate dehydratase large subunit 1 OS=Methanobacterium thermoautotrophicum GN=leuC1 PE=3 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 7.023e-25
Identity = 62/138 (44.93%), Postives = 87/138 (63.04%), Query Frame = 3
Query:  360 AMTLTEKIFARASEKPQLSPGDNVWVNVDILMTHDVCGPGSFGIFKKEFGENAKVWDREKIVIIPDHYIFTSDERANRNVDILRDFCMEQNIKYFYDIKDLGNFKANPDYKGVCHIALAQEGHCRPXEVLLGTDSHTC 773
            +MT++EKI ARAS K ++  G+ V  ++D+ MTHD+ GP S   F+   GE+ +VWD EKIV+I DH +      A +N  I+RDF  EQ I+ FYD+++           GVCH  L ++GH  P EV++GTDSHTC
Sbjct:    2 SMTVSEKILARASGKDRVEAGEIVMADIDVAMTHDLTGPLSVESFRA-IGED-RVWDPEKIVVIFDHQVPADSIEAAQNHMIMRDFVEEQGIRNFYDVRE-----------GVCHQVLPEKGHVVPGEVVVGTDSHTC 126          
BLAST of EY728716 vs. ExPASy Swiss-Prot
Match: LEUC2_METMA (3-isopropylmalate dehydratase large subunit 2 OS=Methanosarcina mazei GN=leuC2 PE=3 SV=2)

HSP 1 Score: 103.219 bits (256), Expect = 2.114e-21
Identity = 60/141 (42.55%), Postives = 84/141 (59.57%), Query Frame = 3
Query:  363 MTLTEKIFARASEKPQLSPGDNVWVNVDILMTHDVCGP----GSFGIFKKEFGENAKVWDREKIVIIPDHYIFTSDERANRNVDILRDFCMEQNIKYFYDIKDLGNFKANPDYKGVCHIALAQEGHCRPXEVLLGTDSHTC 773
            MT++EKIF++AS  P +  GD V  N+D+ MTHD+ GP    G + I + E  E+ KVWD  KIVII DH +      A +N  +LR F  EQ I   YD+           Y+GVCH  L ++GH +P ++++G+DSHTC
Sbjct:    1 MTVSEKIFSKASGTP-VKAGDFVLANIDLAMTHDITGPLAVQGFYEIMRDE--EDKKVWDPSKIVIIFDHQVPADSINAAQNHIMLRKFAKEQGILN-YDV-----------YEGVCHQVLPEKGHVKPGDLIVGSDSHTC 126          
BLAST of EY728716 vs. ExPASy Swiss-Prot
Match: LEUC2_METAC (3-isopropylmalate dehydratase large subunit 2 OS=Methanosarcina acetivorans GN=leuC2 PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.049e-20
Identity = 60/141 (42.55%), Postives = 81/141 (57.45%), Query Frame = 3
Query:  363 MTLTEKIFARASEKPQLSPGDNVWVNVDILMTHDVCGP----GSFGIFKKEFGENAKVWDREKIVIIPDHYIFTSDERANRNVDILRDFCMEQNIKYFYDIKDLGNFKANPDYKGVCHIALAQEGHCRPXEVLLGTDSHTC 773
            MT++EKIF++AS  P +  GD V  N+D+ MTHD+ GP    G + I + E  E  KVWD  KIVII DH +      A  N  +LR F  EQ I   YD+           Y+GVCH  L ++GH  P ++++G+DSHTC
Sbjct:    1 MTVSEKIFSKASGTP-VKAGDFVLANIDLAMTHDITGPLAVQGFYEIMRDE--EEKKVWDPSKIVIIFDHQVPADSINAAENHIMLRKFAKEQGILN-YDV-----------YEGVCHQVLPEKGHVLPGDLIVGSDSHTC 126          
BLAST of EY728716 vs. ExPASy Swiss-Prot
Match: LEUC1_METKA (3-isopropylmalate dehydratase large subunit 1 OS=Methanopyrus kandleri GN=leuC1 PE=3 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 3.053e-20
Identity = 53/136 (38.97%), Postives = 77/136 (56.62%), Query Frame = 3
Query:  366 TLTEKIFARASEKPQLSPGDNVWVNVDILMTHDVCGPGSFGIFKKEFGENAKVWDREKIVIIPDHYIFTSDERANRNVDILRDFCMEQNIKYFYDIKDLGNFKANPDYKGVCHIALAQEGHCRPXEVLLGTDSHTC 773
            T+ EKI +RAS +     GD V  N+D+ M HD+ GP    + + E     +VWD  KIV++ DH +      A  N  I+R+F  EQ I++FYD+++           GVCH  L ++GH RP +V++G DSHTC
Sbjct:    4 TMAEKILSRASGE-DAEAGDIVVANIDVAMVHDITGP--ITVQRLEEMGVERVWDPSKIVVLFDHQVPADSVEAAENHKIMREFVEEQGIEHFYDVRE-----------GVCHQVLPEKGHVRPGDVIVGADSHTC 125          
BLAST of EY728716 vs. ExPASy Swiss-Prot
Match: LEUC_SYNAS (3-isopropylmalate dehydratase large subunit OS=Syntrophus aciditrophicus (strain SB) GN=leuC PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 4.875e-18
Identity = 49/137 (35.77%), Postives = 79/137 (57.66%), Query Frame = 3
Query:  363 MTLTEKIFARASEKPQLSPGDNVWVNVDILMTHDVCGPGSFGIFKKEFGENAKVWDREKIVIIPDHYIFTSDERANRNVDILRDFCMEQNIKYFYDIKDLGNFKANPDYKGVCHIALAQEGHCRPXEVLLGTDSHTC 773
            MT+TEKI  R ++  ++ PG  +   VDI + +DV  P +   F+K  G+  KV+DR+K+V+IPDH+    D  +     I+RDF  EQ I ++Y++ ++          GV H  L ++G   P ++++G DSHTC
Sbjct:    3 MTITEKILCRHTDLDEVRPGMLINAKVDIALGNDVTAPLAIDEFRKAGGK--KVFDRDKVVLIPDHFTPNKDINSAAQCKIMRDFAREQEITHYYEVGEV----------GVEHALLPEKGIVLPGDLVIGADSHTC 127          
BLAST of EY728716 vs. ExPASy Swiss-Prot
Match: LEUC_DESAA (3-isopropylmalate dehydratase large subunit OS=Desulfatibacillum alkenivorans (strain AK-01) GN=leuC PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.160e-17
Identity = 46/137 (33.58%), Postives = 79/137 (57.66%), Query Frame = 3
Query:  363 MTLTEKIFARASEKPQLSPGDNVWVNVDILMTHDVCGPGSFGIFKKEFGENAKVWDREKIVIIPDHYIFTSDERANRNVDILRDFCMEQNIKYFYDIKDLGNFKANPDYKGVCHIALAQEGHCRPXEVLLGTDSHTC 773
            MT+ EKI A  + + + SPGD +   VDI + +D+  P +  +F++     AKV+D++++V++PDH+  T D  +   V ++RDF  EQ + ++Y+  D           GV H  L ++G   P ++++G DSHTC
Sbjct:    3 MTIAEKILAAHAGQEEASPGDLINAKVDIALGNDITAPIAIKLFRQSGA--AKVFDKDRVVLVPDHFTPTKDINSAMQVKMVRDFAREQELSHWYEGGD----------SGVEHALLPEKGIVGPGDLVIGADSHTC 127          
BLAST of EY728716 vs. ExPASy Swiss-Prot
Match: LEUC1_ARCFU (3-isopropylmalate dehydratase large subunit 1 OS=Archaeoglobus fulgidus GN=leuC1 PE=3 SV=2)

HSP 1 Score: 88.5817 bits (218), Expect = 5.390e-17
Identity = 50/138 (36.23%), Postives = 74/138 (53.62%), Query Frame = 3
Query:  360 AMTLTEKIFARASEKPQLSPGDNVWVNVDILMTHDVCGPGSFGIFKKEFGENAKVWDREKIVIIPDHYIFTSDERANRNVDILRDFCMEQNIKYFYDIKDLGNFKANPDYKGVCHIALAQEGHCRPXEVLLGTDSHTC 773
            A TL EKIF++AS K ++  G+ V  N+D+ M HD+  P +   F++  G +AKVWD+ K+++  DH +      A  N  +LR F  EQ I   YD+K            G+ H  +  E H  P  +++G DSHTC
Sbjct:    2 AQTLVEKIFSKASGK-EVKAGEFVMANIDLAMIHDITAPLAIKAFREILGSDAKVWDKSKVIMAFDHQVPADSVHAAENHKMLRKFAEEQGI-LNYDVKG-----------GIAH-QIMVENHVEPGMLIVGADSHTC 125          
BLAST of EY728716 vs. ExPASy Swiss-Prot
Match: LEUC_THEYD (3-isopropylmalate dehydratase large subunit OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=leuC PE=3 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.734e-15
Identity = 44/137 (32.12%), Postives = 79/137 (57.66%), Query Frame = 3
Query:  363 MTLTEKIFARASEKPQLSPGDNVWVNVDILMTHDVCGPGSFGIFKKEFGENAKVWDREKIVIIPDHYIFTSDERANRNVDILRDFCMEQNIKYFYDIKDLGNFKANPDYKGVCHIALAQEGHCRPXEVLLGTDSHTC 773
            MT+ EKI A  + K +++PG+ +   VDI++ +D+  P +   F+K   ++  V+DRE+I ++PDH+    D +A     +LR+F  +  IK++++I  +          G+ H  L +EG   P ++++G DSHTC
Sbjct:    3 MTIAEKILAAHAGKKEVTPGEIINAKVDIVLANDITAPIAIKEFEKLGVKD--VFDRERIALVPDHFTPQKDIKAAEQCKMLREFAQKYKIKHYFEIGRV----------GIEHALLPEEGIVLPGDLVIGADSHTC 127          
The following BLAST results are available for this feature:
BLAST of EY728716 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 46
Match NameE-valueIdentityDescription
LEUC_ARATH1.589e-8572.913-isopropylmalate dehydratase OS=Arabidopsis thali... [more]
LEUC_METJA2.851e-2645.99Isopropylmalate/citramalate isomerase large subuni... [more]
LEUC1_METTH7.023e-2544.933-isopropylmalate dehydratase large subunit 1 OS=M... [more]
LEUC2_METMA2.114e-2142.553-isopropylmalate dehydratase large subunit 2 OS=M... [more]
LEUC2_METAC1.049e-2042.553-isopropylmalate dehydratase large subunit 2 OS=M... [more]
LEUC1_METKA3.053e-2038.973-isopropylmalate dehydratase large subunit 1 OS=M... [more]
LEUC_SYNAS4.875e-1835.773-isopropylmalate dehydratase large subunit OS=Syn... [more]
LEUC_DESAA3.160e-1733.583-isopropylmalate dehydratase large subunit OS=Des... [more]
LEUC1_ARCFU5.390e-1736.233-isopropylmalate dehydratase large subunit 1 OS=A... [more]
LEUC_THEYD1.734e-1532.123-isopropylmalate dehydratase large subunit OS=The... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (5 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-704-007-F06-CT.F Sweet orange fruit, development stadium (5 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY728716 ID=EY728716|Name=EY728716|organism=Citrus sinensis|type=EST|length=905bp
CACGCGTCCGTGATTTTTTATATTGTTTGTGATCAAACTTTCTCTCAGCC
GCCGCCGCCACTTTCTTAGGAAACAAACTAAATTTAGACACTCTTAAATC
TTAATCCCTACAGAACAAACCAAACCAAAAAAAAACAGGCCTCTTGTAGC
AAATAAACATGGCTTCCTCTGTCATTTCCCCAGCTCCAACATCTTCTTTC
ATCAACAACAAGAAGGATTTGGGTAGCTTTTGTTTTTCGTCGACATCACA
ATTTTCAGTCAACAAATGCAAGAAATTGGCAGTCTCCAAGAAAATTGTGT
CGGTCATGGCACCTCAGCAATCAGAACGCCGGCCTGCCACCACTGGCTCG
GTAAAAAATGCGATGACGTTGACGGAGAAGATATTTGCCAGGGCTTCAGA
GAAACCCCAGTTGAGCCCGGGAGACAATGTGTGGGTTAATGTTGATATCT
TGATGACCCACGATGTTTGTGGCCCCGGCTCCTTTGGTATCTTTAAAAAA
GAGTTTGGTGAAAATGCTAAGGTTTGGGACCGTGAAAAGATTGTCATTAT
ACCTGATCATTATATATTCACAAGTGATGAACGTGCAAATCGTAATGTGG
ATATCCTGAGGGATTTCTGCATGGAGCAGAATATCAAGTACTTTTATGAT
ATTAAAGATCTTGGTAACTTTAAGGCTAACCCGGATTATAAAGGCGTATG
TCATATTGCACTTGCCCAAGAAGGCCATTGCAGGCCTGNAGAGGTCTTGC
TAGGTACAGACTCCCACACATGTACTGCTGGAGCATTTGGCCANTTTGCC
ACTGGCATTGGCACACTGATGCAGGTTTATATTGGGCCAGGGAAAGTCTG
CTCAAGGTGCCCCACTCTGAAATTGTATTGGATGTGAATGCTGATAATTG
GCTGC
back to top