EY728711

Overview
NameEY728711
Unique NameEY728711
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length935
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11772 contig Csv1_Contig11772:1..934. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY728711 vs. ExPASy Swiss-Prot
Match: DHRS4_BOVIN (Dehydrogenase/reductase SDR family member 4 OS=Bos taurus GN=DHRS4 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 8.985e-15
Identity = 39/77 (50.65%), Postives = 52/77 (67.53%), Query Frame = 2
Query:   59 IQGKVAIVTASTQGIGFGIAERLGLEGASVVVSSRKQKNVDEAVVKLKAPRIEIIGVVCHVSNGQQKKYLINQTIEV 289
            +  KVA+VTAST GIGF IA RL  +GA VVVSSRKQ+NVD AV  LK   + + G VCHV   + ++ L+   +++
Sbjct:   12 LDNKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDRAVATLKGEGLSVTGTVCHVGKAEDRERLVATAVKL 88          
BLAST of EY728711 vs. ExPASy Swiss-Prot
Match: DHRS4_RAT (Dehydrogenase/reductase SDR family member 4 OS=Rattus norvegicus GN=Dhrs4 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.173e-14
Identity = 38/77 (49.35%), Postives = 53/77 (68.83%), Query Frame = 2
Query:   59 IQGKVAIVTASTQGIGFGIAERLGLEGASVVVSSRKQKNVDEAVVKLKAPRIEIIGVVCHVSNGQQKKYLINQTIEV 289
            +  KVA+VTAST GIG  IA RL  +GA VV+SSRKQ+NVD AV  L+   + + GVVCHV   + ++ L+N  +++
Sbjct:   12 LANKVALVTASTDGIGLAIARRLAEDGAHVVISSRKQQNVDRAVATLQGEGLSVTGVVCHVGKAEDREKLVNMALKL 88          
BLAST of EY728711 vs. ExPASy Swiss-Prot
Match: DHRS4_MOUSE (Dehydrogenase/reductase SDR family member 4 OS=Mus musculus GN=Dhrs4 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.173e-14
Identity = 39/76 (51.32%), Postives = 52/76 (68.42%), Query Frame = 2
Query:   59 IQGKVAIVTASTQGIGFGIAERLGLEGASVVVSSRKQKNVDEAVVKLKAPRIEIIGVVCHVSNGQQKKYLINQTIE 286
            +  KVA+VTAST GIGF IA RL  +GA VVVSSRKQ+NVD AV  L+   + + G+VCHV   + ++ LI   ++
Sbjct:   12 LSNKVALVTASTDGIGFAIARRLAEDGAHVVVSSRKQQNVDRAVATLQGEGLSVTGIVCHVGKAEDREKLITTALK 87          
BLAST of EY728711 vs. ExPASy Swiss-Prot
Match: DHRS2_HUMAN (Dehydrogenase/reductase SDR family member 2 OS=Homo sapiens GN=DHRS2 PE=1 SV=3)

HSP 1 Score: 80.8777 bits (198), Expect = 1.173e-14
Identity = 36/76 (47.37%), Postives = 53/76 (69.74%), Query Frame = 2
Query:   59 IQGKVAIVTASTQGIGFGIAERLGLEGASVVVSSRKQKNVDEAVVKLKAPRIEIIGVVCHVSNGQQKKYLINQTIE 286
            +  +VA+VT ST GIGF IA RL  +GA VV+SSRKQ+NVD A+ KL+   + + G+VCHV   + ++ L+ + +E
Sbjct:   12 LANRVAVVTGSTSGIGFAIARRLARDGAHVVISSRKQQNVDRAMAKLQGEGLSVAGIVCHVGKAEDREQLVAKALE 87          
BLAST of EY728711 vs. ExPASy Swiss-Prot
Match: DHRS4_PONAB (Dehydrogenase/reductase SDR family member 4 OS=Pongo abelii GN=DHRS4 PE=2 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 2.002e-14
Identity = 38/77 (49.35%), Postives = 53/77 (68.83%), Query Frame = 2
Query:   59 IQGKVAIVTASTQGIGFGIAERLGLEGASVVVSSRKQKNVDEAVVKLKAPRIEIIGVVCHVSNGQQKKYLINQTIEV 289
            +  KVA+VTAST GIGF IA RL  +GA VVVSSRKQ+NVD+AV  L+   + + G VCHV   + ++ L+   +++
Sbjct:   12 LANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKL 88          
BLAST of EY728711 vs. ExPASy Swiss-Prot
Match: DHRS4_HUMAN (Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens GN=DHRS4 PE=1 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 2.002e-14
Identity = 38/77 (49.35%), Postives = 53/77 (68.83%), Query Frame = 2
Query:   59 IQGKVAIVTASTQGIGFGIAERLGLEGASVVVSSRKQKNVDEAVVKLKAPRIEIIGVVCHVSNGQQKKYLINQTIEV 289
            +  KVA+VTAST GIGF IA RL  +GA VVVSSRKQ+NVD+AV  L+   + + G VCHV   + ++ L+   +++
Sbjct:   12 LANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKL 88          
BLAST of EY728711 vs. ExPASy Swiss-Prot
Match: DHRS4_PIG (Dehydrogenase/reductase SDR family member 4 OS=Sus scrofa GN=DHRS4 PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 5.824e-14
Identity = 38/82 (46.34%), Postives = 52/82 (63.41%), Query Frame = 2
Query:   44 EDGKKIQGKVAIVTASTQGIGFGIAERLGLEGASVVVSSRKQKNVDEAVVKLKAPRIEIIGVVCHVSNGQQKKYLINQTIEV 289
            E  K ++ KVA+VTAST GIG  IA RL  +GA VVVSSRKQ+NVD  V  L+   + + G VCHV   + ++ L+   + +
Sbjct:    7 ERRKPLENKVALVTASTDGIGLAIARRLAQDGAHVVVSSRKQENVDRTVATLQGEGLSVTGTVCHVGKAEDRERLVAMAVNL 88          
BLAST of EY728711 vs. ExPASy Swiss-Prot
Match: DHRS4_RABIT (Dehydrogenase/reductase SDR family member 4 OS=Oryctolagus cuniculus GN=DHRS4 PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 7.606e-14
Identity = 38/71 (53.52%), Postives = 49/71 (69.01%), Query Frame = 2
Query:   59 IQGKVAIVTASTQGIGFGIAERLGLEGASVVVSSRKQKNVDEAVVKLKAPRIEIIGVVCHVSNGQQKKYLI 271
            +  KVAIVTAST GIG  IA RL  +GA VV+SSRKQ+NVD AV  L+A  + + G VCHV   + ++ L+
Sbjct:   12 LANKVAIVTASTDGIGLAIARRLAQDGAHVVISSRKQQNVDRAVAALQAEGLSVTGTVCHVGKAEDRERLV 82          
BLAST of EY728711 vs. ExPASy Swiss-Prot
Match: DR4L2_HUMAN (Dehydrogenase/reductase SDR family member 4-like 2 OS=Homo sapiens GN=DHRS4L2 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.297e-13
Identity = 37/77 (48.05%), Postives = 52/77 (67.53%), Query Frame = 2
Query:   59 IQGKVAIVTASTQGIGFGIAERLGLEGASVVVSSRKQKNVDEAVVKLKAPRIEIIGVVCHVSNGQQKKYLINQTIEV 289
            +  KVA+VTAST GIGF IA RL  + A VVVSSRKQ+NVD+AV  L+   + + G VCHV   + ++ L+   +++
Sbjct:   28 LTNKVALVTASTDGIGFAIARRLAQDRAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVAMAVKL 104          
The following BLAST results are available for this feature:
BLAST of EY728711 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
DHRS4_BOVIN8.985e-1550.65Dehydrogenase/reductase SDR family member 4 OS=Bos... [more]
DHRS4_RAT1.173e-1449.35Dehydrogenase/reductase SDR family member 4 OS=Rat... [more]
DHRS4_MOUSE1.173e-1451.32Dehydrogenase/reductase SDR family member 4 OS=Mus... [more]
DHRS2_HUMAN1.173e-1447.37Dehydrogenase/reductase SDR family member 2 OS=Hom... [more]
DHRS4_PONAB2.002e-1449.35Dehydrogenase/reductase SDR family member 4 OS=Pon... [more]
DHRS4_HUMAN2.002e-1449.35Dehydrogenase/reductase SDR family member 4 OS=Hom... [more]
DHRS4_PIG5.824e-1446.34Dehydrogenase/reductase SDR family member 4 OS=Sus... [more]
DHRS4_RABIT7.606e-1453.52Dehydrogenase/reductase SDR family member 4 OS=Ory... [more]
DR4L2_HUMAN1.297e-1348.05Dehydrogenase/reductase SDR family member 4-like 2... [more]
back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (5 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-704-007-F01-CT.F Sweet orange fruit, development stadium (5 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY728711 ID=EY728711|Name=EY728711|organism=Citrus sinensis|type=EST|length=935bp
CCACGCGTCCGCAAGAAAGCAAGCCGAACCTAATGGAGAAGATGAAGATG
GCAAAAAGATCCAAGGGAAGGTGGCGATCGTAACGGCTTCGACTCAGGGC
ATTGGCTTCGGCATCGCTGAGCGGCTCGGCTTGGAAGGCGCCTCCGTGGT
TGTCTCTTCACGAAAGCAGAAAAATGTGGATGAAGCAGTTGTCAAACTCA
AAGCTCCAAGAATCGAAATTATTGGAGTTGTTTGTCATGTGTCAAATGGA
CAACAGAAAAAGTATCTCATAAACCAAACTATTGAAGTGAAGAATTTAAT
TGTACCTTTTTTATTATCACACAAACTACCTGATTAAATGGAAAATTAAA
ATTAAAAAAATGATCAGTAGTTGAAAGAAATTTTGTCCACTATAATTAAC
AGCGCTCTGTTGAATTTGGTGAACTATTGTTTGTTTCTATCTCAACAATC
TGTGGATTTGTTTCAGTAATCCCATCCCAAAGATACACTAGATATGTGGA
ATATGAGTTATATTCCCAATTTCGGTTTCATGTTGTGTTGCTGAGTGGTC
TGTTTCACACATATGGAGAAATAGATGTGGTTGTGTCAAATGCTGCTGCC
AATCCCTCTGTTGATTACATCCTGCGAACCACAGAATCAGTTCTCGTCNA
GTTATGGGATATCAATGTGTAATCAAGTATACTTCTTCTACAGGATGCTG
CTCCTCACTTGCAGAAGGGGTCTTCANNTTGTTTNGATATCCTCTATAGC
TGGCTATAAACCACAGTCATCTATGGCCATGTATGGAGTCACTAAAACGG
CTTTGTTANGTTTGACCAAGGCTCTTGCCACTGAAATGGTCCAGAACTCG
TGTCATTGGTGTGCTCTGGTTTTGTACAACACCTTGCTGAGTCTCCAATA
ATGATGGTTGAACGACATGAGCAACCTTTGTCATA
back to top