EY728701

Overview
NameEY728701
Unique NameEY728701
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length868
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY728701 vs. ExPASy Swiss-Prot
Match: WDTC1_HUMAN (WD and tetratricopeptide repeats protein 1 OS=Homo sapiens GN=WDTC1 PE=1 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 3.612e-15
Identity = 63/188 (33.51%), Postives = 88/188 (46.81%), Query Frame = 1
Query:   79 HTRRVKKLAVEVGNPHVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRNILLDLR--CGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFARLYDRRMLPPLTSCQKRMSPPPCVNYFC-------------------PMHLSEHGR--SSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNH 573
            HT RVK++A     P+  WSA+EDG +RQ+D R+        S H E   +L+DL   CG          Q +  K   ++    + L VG S  F RLYD RM+       K+ SP   V+ FC                   P+ L ++      L  T+VTFSPNG E+L++  GE VYL D+ +
Sbjct:  133 HTNRVKRIATAPMWPNTFWSAAEDGLIRQYDLRE-------NSKHSE---VLIDLTEYCG----------QLVEAKCLTVNPQDNNCLAVGASGPFVRLYDIRMIHNHRKSMKQ-SPSAGVHTFCDRQKPLPDGAAQYYVAGHLPVKLPDYNNRLRVLVATYVTFSPNGTELLVNMGGEQVYLFDLTY 299          
BLAST of EY728701 vs. ExPASy Swiss-Prot
Match: WDTC1_MOUSE (WD and tetratricopeptide repeats protein 1 OS=Mus musculus GN=Wdtc1 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.058e-14
Identity = 62/188 (32.98%), Postives = 86/188 (45.74%), Query Frame = 1
Query:   79 HTRRVKKLAVEVGNPHVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRNILLDLR--CGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFARLYDRRMLPPLTSCQKRMSPPPCVNYFC-------------------PMHLSEHGR--SSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNH 573
            HT RVK++A     P+  WSA+EDG +RQ+D R+        S H E   +L+DL   CG            +  K   ++    + L VG S  F RLYD RM+        R SP   V+ FC                   P+ L ++      L  T+VTFSPNG E+L++  GE VYL D+ +
Sbjct:  133 HTNRVKRIATAPMWPNTFWSAAEDGLIRQYDLRE-------NSKHSE---VLIDLTEYCG----------PMVEAKCLTVNPQDNNCLAVGASGPFVRLYDIRMIHNHRK-SMRQSPSAGVHTFCDRQKPLPDGAAQYYVAGHLPVKLPDYNSRLRVLVATYVTFSPNGTELLVNMGGEQVYLFDLTY 299          
BLAST of EY728701 vs. ExPASy Swiss-Prot
Match: DCAF6_MOUSE (DDB1- and CUL4-associated factor 6 OS=Mus musculus GN=Dcaf6 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.862e-12
Identity = 53/177 (29.94%), Postives = 82/177 (46.33%), Query Frame = 1
Query:   70 YQCHTRRVKKLAVEVGNPHVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRN-ILLDLRCGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFARLYDRRMLPP-LTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHAGGRAMR 594
            + CH     ++     +P+   S  EDGT+R  D R  +SC     + ++C++ IL++ R  A      PP               P+ L VG SD+  R+YDRRML    T           V  F P HLS     S  +T + +S +G+E+L+SYS +++YL D      R ++
Sbjct:  137 FTCHYGTTYEIMTVPNDPYTFLSCGEDGTVRWFDTRIKTSC-----TKEDCKDDILINCRRAATSVAICPPV--------------PYYLAVGCSDSSVRIYDRRMLGTRATGNYAGRGTTGMVARFIPSHLSN---KSCRVTSLCYSEDGQEILVSYSSDYIYLFDPKDDTARELK 291          
BLAST of EY728701 vs. ExPASy Swiss-Prot
Match: DCAF6_PONAB (DDB1- and CUL4-associated factor 6 OS=Pongo abelii GN=DCAF6 PE=2 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 8.327e-12
Identity = 52/177 (29.38%), Postives = 82/177 (46.33%), Query Frame = 1
Query:   70 YQCHTRRVKKLAVEVGNPHVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRN-ILLDLRCGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFARLYDRRMLPP-LTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHAGGRAMR 594
            + CH     ++     +P+   S  EDGT+R  D R  +SC     + ++C++ IL++ R  A      PP               P+ L VG SD+  R+YDRRML    T           V  F P HL+     S  +T + +S +G+E+L+SYS +++YL D      R ++
Sbjct:  137 FTCHYGTTYEIMTVPNDPYTFLSCGEDGTVRWFDTRIKTSC-----TKEDCKDDILINCRRAATSVAICPPI--------------PYYLAVGCSDSSVRIYDRRMLGTRATGNYAGRGTTGMVARFIPSHLNN---KSCRVTSLCYSEDGQEILVSYSSDYIYLFDPKDDTARELK 291          
BLAST of EY728701 vs. ExPASy Swiss-Prot
Match: DCAF6_HUMAN (DDB1- and CUL4-associated factor 6 OS=Homo sapiens GN=DCAF6 PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 8.327e-12
Identity = 52/177 (29.38%), Postives = 82/177 (46.33%), Query Frame = 1
Query:   70 YQCHTRRVKKLAVEVGNPHVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRN-ILLDLRCGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFARLYDRRMLPP-LTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHAGGRAMR 594
            + CH     ++     +P+   S  EDGT+R  D R  +SC     + ++C++ IL++ R  A      PP               P+ L VG SD+  R+YDRRML    T           V  F P HL+     S  +T + +S +G+E+L+SYS +++YL D      R ++
Sbjct:  137 FTCHYGTTYEIMTVPNDPYTFLSCGEDGTVRWFDTRIKTSC-----TKEDCKDDILINCRRAATSVAICPPI--------------PYYLAVGCSDSSVRIYDRRMLGTRATGNYAGRGTTGMVARFIPSHLNN---KSCRVTSLCYSEDGQEILVSYSSDYIYLFDPKDDTARELK 291          
The following BLAST results are available for this feature:
BLAST of EY728701 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
WDTC1_HUMAN3.612e-1533.51WD and tetratricopeptide repeats protein 1 OS=Homo... [more]
WDTC1_MOUSE3.058e-1432.98WD and tetratricopeptide repeats protein 1 OS=Mus ... [more]
DCAF6_MOUSE2.862e-1229.94DDB1- and CUL4-associated factor 6 OS=Mus musculus... [more]
DCAF6_PONAB8.327e-1229.38DDB1- and CUL4-associated factor 6 OS=Pongo abelii... [more]
DCAF6_HUMAN8.327e-1229.38DDB1- and CUL4-associated factor 6 OS=Homo sapiens... [more]
back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (5 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-704-007-D12-CT.F Sweet orange fruit, development stadium (5 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY728701 ID=EY728701|Name=EY728701|organism=Citrus sinensis|type=EST|length=868bp
CCACGCGTCCGTCTGTCTCGCTTTAGTGGGAGAGGACTTGATGATAATGC
TATTACTCCATCGGCACTGTATCAGTGTCATACCAGAAGAGTAAAAAAGT
TAGCTGTTGAAGTTGGAAATCCACATGTGGTCTGGAGTGCAAGTGAAGAC
GGGACTTTGAGGCAGCATGATTTTCGACAGGGTTCTTCTTGTCCTCCTGC
CGGATCTTCTCATCAAGAATGTCGTAATATTCTACTTGATTTACGGTGTG
GAGCAAAGAGGTCGCTAGCTGATCCCCCTAAACAAACTCTTTCTCTAAAA
TCTTGTGATATCAGTTCTACGAGGCCTCATTTACTCCTGGTTGGTGGAAG
TGATGCATTTGCTCGTCTGTATGATAGAAGGATGCTGCCTCCACTAACTT
CCTGTCAGAAAAGGATGTCACCACCACCTTGTGTTAACTATTTCTGCCCT
ATGCATCTTTCTGAACATGGACGCTCAAGCTTGCACCTGACTCATGTTAC
ATTTAGTCCCAATGGCGAAGAGGTTCTCCTTAGTTATAGTGGAGAGCATG
TATATCTAATGGATGTAAATCATGCTGGTGGGCGTGCCATGCGATATACT
GTANGAGACGNCTTCAAAATTATGAGCTTTACACCAACACTCCATGGGTT
AGAATTGCAGCCCACCATACATGATTTTCTCCCAACCCATATTCGTGTCA
GGGGGGGAAGTGGNCACAGGGGCTTGGAAAGTGCAAAATGTTANTNGAAA
TTGCTAAAAATTCATTGGAAGAAGGGAAACATCCTTATTATGGAATTGAN
GGCATGCATGAANTTTTGGANGGGGATCTCAGTGGCATTGGACCATGCTG
AAGCATGAATGTCTTGCC
back to top