EY728617

Overview
NameEY728617
Unique NameEY728617
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length904
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY728617 vs. ExPASy Swiss-Prot
Match: FIG4_YEAST (Polyphosphoinositide phosphatase OS=Saccharomyces cerevisiae GN=FIG4 PE=1 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.237e-29
Identity = 76/190 (40.00%), Postives = 105/190 (55.26%), Query Frame = 1
Query:  217 RYKKLLSSVDLTKDFFFSYSYNIMNSLQKNLCNNGT------------GQSQYESMFVWNHFLTRGIRNTLKNN-QWTVALVYGFFKQENLSVAGRDFKFTLIARRSRHYAGTRYLKRGVNEKGRVANDVETEQIVVEDVPEXYPM---------QISSVVQVRGSIPLFWSQETSWMNIKA*IILSKKD 720
            R   +   +DLTK F+FSY+Y+I N+LQ N+                 G + Y  MFVWN+ L   I   +     W   +++GF  Q N+SV G+    TLIARRS H+AG R+LKRGVN KG VAN+VETEQIV + +   +           + +S VQ RGSIPL+W+Q+ S +  K  I ++  D
Sbjct:  161 RLLNIFKDLDLTKTFYFSYTYDITNTLQTNILREKLKAVDRCDITIPCGITDYNEMFVWNNNLLSPIFACIDTVFDWFQCIIHGFIDQVNVSVLGKSIYITLIARRSHHFAGARFLKRGVNNKGHVANEVETEQIVTDMILTPFHQPGNGFFDSDRYTSFVQHRGSIPLYWTQDASNLTTKPPIRINVVD 350          
BLAST of EY728617 vs. ExPASy Swiss-Prot
Match: FIG4_MOUSE (Polyphosphoinositide phosphatase OS=Mus musculus GN=Fig4 PE=1 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 8.016e-29
Identity = 91/242 (37.60%), Postives = 127/242 (52.48%), Query Frame = 1
Query:  217 RYKKLLSSVDLTKDFFFSYSYNIMNSLQKNLC-------------------------------NNGTG----QSQYESMFVWNHFLTRGIRNTLKNNQWTVALVYGFFKQENLSVAGRDFKFTLIARRSRHYAGTRYLKRGVNEKGRVANDVETEQIVVE-DVPEXYPMQISSVVQVRGSIPLFWSQETSWMNIKA*IILSKKDQNMR-AQDSF*KSCKRIWNPMIVLI*LDHEKS*KKHLR 831
            RY ++  +VDL+ +F+FSYSY++ +SLQ NL                                  G+G     S+    +VWN  L   I+NT+ +  W + +++GF  Q  L + GR    TLIARRS  +AGTR+LKRG N +G VAN+VETEQI+ +  V        SS VQVRGS+PLFWSQ+ S M  K  I L + D     A   F +  +R  +P+I+L  L  E+  +KH R
Sbjct:  149 RYLRIFQNVDLSSNFYFSYSYDLSHSLQYNLTVLRMPLEMLKSETSKACQESFDIFEDEGLITQGGSGVFGISSEPYMKYVWNGELLDIIKNTV-HRDWLLYIIHGFCGQSKLLIYGRPVYVTLIARRSSRFAGTRFLKRGANCEGDVANEVETEQILCDASVMSFTAGSYSSYVQVRGSVPLFWSQDISTMMPKPPITLDQADPFAHVAALHFDQMLQRFGSPIIILN-LVKEREKRKHER 388          
BLAST of EY728617 vs. ExPASy Swiss-Prot
Match: YLE3_SCHPO (Uncharacterized protein C1093.03 OS=Schizosaccharomyces pombe GN=SPAC1093.03 PE=2 SV=2)

HSP 1 Score: 125.561 bits (314), Expect = 3.979e-28
Identity = 69/158 (43.67%), Postives = 97/158 (61.39%), Query Frame = 1
Query:  232 LSSVDLTKDFFFSYSYNIMNSLQKNLCNNGTGQSQYESMFVWNHFLTRGIRNTLK-NNQWTVALVYGFFKQENLSVAGRDFKFTLIARRSRHYAGTRYLKRGVNEKGRVANDVETEQIVVEDVPEXYPMQ--------ISSVVQVRGSIPLFWSQETS 678
            +  VDL + F+FSYSY++  ++Q     +   Q Q   MFVWN  + R I +++  ++ W + L++GF  Q  LSV G+    TLIARRSRH+AG R+L+RG+ + G VAN+VETEQIV +     +P+          +S VQ RGSIPL WSQE S
Sbjct:  141 IEKVDLARTFYFSYSYDLSQTIQYGF-THPIPQHQVRDMFVWNWNMLRPILDSVGIDSPWCIPLIHGFVDQAKLSVYGKPIIVTLIARRSRHFAGARFLRRGIRDDGYVANEVETEQIVFDGSASSFPISSTTPGIPCYTSYVQHRGSIPLRWSQEFS 297          
BLAST of EY728617 vs. ExPASy Swiss-Prot
Match: FIG4_HUMAN (Polyphosphoinositide phosphatase OS=Homo sapiens GN=FIG4 PE=1 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.512e-27
Identity = 89/242 (36.78%), Postives = 128/242 (52.89%), Query Frame = 1
Query:  217 RYKKLLSSVDLTKDFFFSYSYNIMNSLQKNLC---------NNGTGQSQYESM--------------------------FVWNHFLTRGIRNTLKNNQWTVALVYGFFKQENLSVAGRDFKFTLIARRSRHYAGTRYLKRGVNEKGRVANDVETEQIVVE-DVPEXYPMQISSVVQVRGSIPLFWSQETSWMNIKA*IILSKKDQNMR-AQDSF*KSCKRIWNPMIVLI*LDHEKS*KKHLR 831
            RY ++  +VDL+ +F+FSYSY++ +SLQ NL           +   Q++ ES                           +VWN  L   I++T+ +  W + +++GF  Q  L + GR    TLIARRS  +AGTR+LKRG N +G VAN+VETEQI+ +  V        SS VQVRGS+PL+WSQ+ S M  K  I L + D     A   F +  +R  +P+I+L  L  E+  +KH R
Sbjct:  149 RYLRIFQNVDLSSNFYFSYSYDLSHSLQYNLTVLRMPLEMLKSEMTQNRQESFDIFEDEGLITQGGSGVFGICSEPYMKYVWNGELLDIIKSTV-HRDWLLYIIHGFCGQSKLLIYGRPVYVTLIARRSSKFAGTRFLKRGANCEGDVANEVETEQILCDASVMSFTAGSYSSYVQVRGSVPLYWSQDISTMMPKPPITLDQADPFAHVAALHFDQMFQRFGSPIIILN-LVKEREKRKHER 388          
BLAST of EY728617 vs. ExPASy Swiss-Prot
Match: SAC1_YEAST (Phosphoinositide phosphatase SAC1 OS=Saccharomyces cerevisiae GN=SAC1 PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.371e-20
Identity = 55/155 (35.48%), Postives = 84/155 (54.19%), Query Frame = 1
Query:  220 YKKLLSSVDLTKDFFFSYSYNIMNSLQKN-LCNNGTGQSQYESMFVWNHFLTRGIRNTLKNN----QWTVALVYGFFKQENLSVAGRDFKFTLIARRSRHYAGTRYLKRGVNEKGRVANDVETEQIVVEDVPEXYPMQISSVVQVRGSIPLFWSQ 669
            Y KLL        F+FSY+Y++ NSLQ+N            +  F WNH+LT  +RN    +     +   ++YG+ K  +  +        LI RRS   AGTRY +RGV++ G V N  ETEQI++ + PE   + + S +Q RGS+P++W++
Sbjct:  111 YIKLLELHLKNSTFYFSYTYDLTNSLQRNEKVGPAASWKTADERFFWNHYLTEDLRNFAHQDPRIDSFIQPVIYGYAKTVDAVLNATPIVLGLITRRSIFRAGTRYFRRGVDKDGNVGNFNETEQILLAENPESEKIHVFSFLQTRGSVPIYWAE 265          
BLAST of EY728617 vs. ExPASy Swiss-Prot
Match: SAC1_RAT (Phosphatidylinositide phosphatase SAC1 OS=Rattus norvegicus GN=Sacm1l PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 4.875e-18
Identity = 57/154 (37.01%), Postives = 89/154 (57.79%), Query Frame = 1
Query:  229 LLSSVDLTKDFFFSYSYNIMNSLQKNLCNNGTGQSQYESM-------FVWNHFLTRGIRNTLKNNQWTVALVYGFFKQENLSVAGRDFKFTLIARRSRHYAGTRYLKRGVNEKGRVANDVETEQIVVEDVPEXYPMQISSVVQVRGSIPLFWSQ 669
            +L+ V  T  F+FS +Y++ ++LQ+   +N + + Q  S+       FVWN  L R +    + +++ + +++GF    + S+ G+ F + LI+RRS   AG RY  RG++ +G  AN VETEQIV       Y    +S VQ RGSIP+FWSQ
Sbjct:  121 MLNHVLSTDGFYFSTTYDLTHTLQR--LSNTSPEFQEMSLLERADQRFVWNGHLLRELSAQPEVHRFALPVLHGFITMHSCSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIV------HYSGNRASFVQTRGSIPVFWSQ 266          
BLAST of EY728617 vs. ExPASy Swiss-Prot
Match: SAC1_DROME (Phosphatidylinositide phosphatase SAC1 OS=Drosophila melanogaster GN=Sac1 PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 8.315e-18
Identity = 61/159 (38.36%), Postives = 84/159 (52.83%), Query Frame = 1
Query:  220 YKKLLSSVDLTKDFFFSYSYNIMNSLQKNLCNNGTGQSQ---------YESMFVWNHFLTRGIRNTLKNNQWTVALVYGFFKQENLSVAGRDFKFTLIARRSRHYAGTRYLKRGVNEKGRVANDVETEQIVVEDVPEXYPMQISSVVQVRGSIPLFWSQ 669
            Y +LL     TK F+FSY Y++ NSLQ+        QS+          E  FVWN ++ R   N  K  ++ + LV GF     + + G+ F +++I RRS   AGTR   RG +E+G VAN VETEQIV       +  Q++  VQ RGS+P  W Q
Sbjct:  117 YLRLLRQTLDTKFFYFSYRYDLTNSLQRQ---REVAQSRPEVSGLLQRAEQRFVWNGYVLRQF-NCDKMEKFQLPLVLGFVSINQVQINGQTFFWSIITRRSVQRAGTRLFCRGSDEQGHVANFVETEQIV------EFNGQLTGFVQTRGSMPFHWHQ 265          
BLAST of EY728617 vs. ExPASy Swiss-Prot
Match: SAC1_DICDI (Phosphatidylinositide phosphatase SAC1 OS=Dictyostelium discoideum GN=sac1 PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 8.315e-18
Identity = 61/164 (37.20%), Postives = 88/164 (53.66%), Query Frame = 1
Query:  196 HFSLVMCRYKKLLSSVDLTKDFFFSYSYNIMNSLQKNLCNNGTGQS------QYESMFVWNHFLTRGIRNTLKNNQWTVALVYGFFKQENLSVAGRDFKFTLIARRSRHYAGTRYLKRGVNEKGRVANDVETEQIVVEDVPEXYPMQISSVVQVRGSIPLFWSQ 669
            H S++    + LLSS    ++F+FSY Y+   +LQ+      T  S      + +S F WN      +        W + +  GF + + L   G   +FTLI+RR+ + +GTRY  RG+++KG VAN+VETEQI+     E      +S VQVRGSIPL WSQ
Sbjct:  115 HLSMI----RWLLSS----ENFYFSYDYDFTLTLQRQYSTTTTTTSGSSLGERCDSRFFWNEKYVTILSKEHGLGDWILPITMGFVESKTL---GGTCQFTLISRRNLNRSGTRYNVRGIDKKGNVANNVETEQII-----EIKENTFTSFVQVRGSIPLLWSQ 262          
BLAST of EY728617 vs. ExPASy Swiss-Prot
Match: YG23_SCHPO (Uncharacterized protein C19F5.03 OS=Schizosaccharomyces pombe GN=SPBC19F5.03 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.418e-17
Identity = 51/146 (34.93%), Postives = 79/146 (54.11%), Query Frame = 1
Query:  250 TKDFFFSYSYNIMNSLQKNLCNNGTGQS--QYESMFVWNHFLTRGIRNTLKNNQ----WTVALVYGFFKQENLSVAGRDFKFTLIARRSRHYAGTRYLKRGVNEKGRVANDVETEQIVVEDVPEXYPMQISSVVQVRGSIPLFWSQ 669
            T  F+FSY++++ NSLQ++  + G      + +  F WN F ++   + +  +     +   ++YGF    +  V GR     LI+RRS+  AGTRY  RG++E G  AN  ETEQI +  V +       S VQ RGS+P FW++
Sbjct:  112 TGPFYFSYTWDLTNSLQRSCTDEGKASPILRSDKRFFWNEFASKDFIDLIGAHSEVSLFITPMIYGFITSASTIVKGRTITLALISRRSKQRAGTRYFTRGLDENGNPANFNETEQITI--VSDEKSEVTYSHVQTRGSVPAFWAE 255          
BLAST of EY728617 vs. ExPASy Swiss-Prot
Match: SAC1_MOUSE (Phosphatidylinositide phosphatase SAC1 OS=Mus musculus GN=Sacm1l PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.852e-17
Identity = 56/154 (36.36%), Postives = 88/154 (57.14%), Query Frame = 1
Query:  229 LLSSVDLTKDFFFSYSYNIMNSLQKNLCNNGTGQSQYESM-------FVWNHFLTRGIRNTLKNNQWTVALVYGFFKQENLSVAGRDFKFTLIARRSRHYAGTRYLKRGVNEKGRVANDVETEQIVVEDVPEXYPMQISSVVQVRGSIPLFWSQ 669
            +L+ V     F+FS +Y++ ++LQ+   +N + + Q  S+       FVWN  L R +    + +++ + +++GF    + S+ G+ F + LI+RRS   AG RY  RG++ +G  AN VETEQIV       Y    +S VQ RGSIP+FWSQ
Sbjct:  121 MLNHVLSMDGFYFSTTYDLTHTLQR--LSNTSPEFQEMSLLERADQRFVWNGHLLRELSAQPEVHRFALPVLHGFITMHSCSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIV------HYSGNRASFVQTRGSIPIFWSQ 266          
The following BLAST results are available for this feature:
BLAST of EY728617 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 29
Match NameE-valueIdentityDescription
FIG4_YEAST1.237e-2940.00Polyphosphoinositide phosphatase OS=Saccharomyces ... [more]
FIG4_MOUSE8.016e-2937.60Polyphosphoinositide phosphatase OS=Mus musculus G... [more]
YLE3_SCHPO3.979e-2843.67Uncharacterized protein C1093.03 OS=Schizosaccharo... [more]
FIG4_HUMAN1.512e-2736.78Polyphosphoinositide phosphatase OS=Homo sapiens G... [more]
SAC1_YEAST1.371e-2035.48Phosphoinositide phosphatase SAC1 OS=Saccharomyces... [more]
SAC1_RAT4.875e-1837.01Phosphatidylinositide phosphatase SAC1 OS=Rattus n... [more]
SAC1_DROME8.315e-1838.36Phosphatidylinositide phosphatase SAC1 OS=Drosophi... [more]
SAC1_DICDI8.315e-1837.20Phosphatidylinositide phosphatase SAC1 OS=Dictyost... [more]
YG23_SCHPO1.418e-1734.93Uncharacterized protein C19F5.03 OS=Schizosaccharo... [more]
SAC1_MOUSE1.852e-1736.36Phosphatidylinositide phosphatase SAC1 OS=Mus musc... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (5 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-704-006-C09-CT.F Sweet orange fruit, development stadium (5 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY728617 ID=EY728617|Name=EY728617|organism=Citrus sinensis|type=EST|length=904bp
CCACGCGTCCGCAACATTGCCGTAGGTGATGTTATTATTAATTGTTGATT
GAGGCAAGGTATCATTGGGGTTTGTAGGGACAACAGTTTCTTTCCTTTTT
GTTTTAAATTTATAGCTTTTTTTTTTTCCTTAAATTCTTTCCACTTTGAT
CAATGTATTATACATGTTTTAACGTGCTTTGCTTTTCTTTCCATCCATTT
TTCTCTTGTGATGTGTAGATACAAGAAGCTCCTCAGCTCTGTGGATCTTA
CGAAGGACTTCTTTTTCAGCTACTCATACAATATCATGAATAGTCTTCAA
AAGAACTTATGTAATAATGGGACAGGACAATCACAGTATGAATCAATGTT
TGTCTGGAATCATTTCTTGACTCGTGGAATTCGGAATACTCTCAAGAATA
ATCAGTGGACTGTTGCATTAGTATATGGATTCTTTAAGCAGGAGAACCTT
TCTGTAGCTGGGAGGGACTTCAAGTTCACTCTCATTGCAAGACGCTCACG
GCATTATGCTGGCACAAGATATTTGAAACGCGGTGTCAATGAGAAGGGTA
GAGTAGCCAATGATGTTGAGACGGAACAGATTGTGGTTGAAGATGTTCCT
GAANGATACCCAATGCAAATCAGTTCTGTTGTACAAGTCCGTGGATCGAT
CCCACTTTTCTGGTCTCAGGAGACGTCATGGATGAATATTAAAGCCTGAA
TTATATTATCAAAGAAAGATCAAAATATGAGGGCCCAAGATTCATTTTGA
AAATCTTGCAAAAGGATATGGAATCCTATGATAGTCTTGATTTGATTAGA
CCATGAGAAAAGCTGAAAGAAACATCTTCGGGCACAGTTGAAATGCTATT
CGTTCTTGATAACAATTGTCGAACGAAACCGCCTAAATCCTTAGGTTGAC
TCCC
back to top