EY728612

Overview
NameEY728612
Unique NameEY728612
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length912
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig722 contig Csv1_Contig722:175..1089. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY728612 vs. ExPASy Swiss-Prot
Match: CCR4F_ARATH (Carbon catabolite repressor protein 4 homolog 6 OS=Arabidopsis thaliana GN=CCR4-6 PE=2 SV=2)

HSP 1 Score: 190.274 bits (482), Expect = 1.337e-47
Identity = 104/196 (53.06%), Postives = 128/196 (65.31%), Query Frame = 1
Query:   13 DAWARELSLGNL--DETKA---ESESIREDGNAFLFALHSTEDSSQSNFDHYAQSNLDPNSEELGDELIDDLSPALDSEAVNAEETTYNPSLWTPMEIATATGNADCTYLEHPLQLRSTYAEVEDCTGTRDSQXEPLVTSYNRRFKGTVDYILRSEGLQTVRVLAPIPKHAMQWTPGYPTKKWGSDHIALASEVAF 585
            D +  E+ L  L  DE      + ES+ EDG  FL  LH   +                N  + G EL+ ++     SEA+N+++ TY+PS WTPMEIATATG+ + T +EH L+L+STY+EVE    TRD   EP+VTSY+R F GTVDYI RSEGLQTVRVLAPIPK AMQWTPG+PT KWGSDHIAL SE+AF
Sbjct:  567 DTFVAEMKLDGLKLDEPVVFAQDEESLGEDGETFLAKLHDNNE----------------NLSQKG-ELVSEVPLKWSSEALNSDKITYSPSSWTPMEIATATGDPERTTVEHALELKSTYSEVEGQANTRDENGEPVVTSYHRCFMGTVDYIWRSEGLQTVRVLAPIPKQAMQWTPGFPTPKWGSDHIALVSELAF 745          
BLAST of EY728612 vs. ExPASy Swiss-Prot
Match: CCR4C_ARATH (Carbon catabolite repressor protein 4 homolog 3 OS=Arabidopsis thaliana GN=CCR4-3 PE=2 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 8.165e-21
Identity = 61/160 (38.12%), Postives = 91/160 (56.88%), Query Frame = 1
Query:  112 HSTEDSSQSNFDHYAQSN-LDPNSEELGDELIDDLSPALDSEAVNAEETTYN-PSLWTPMEIATATGNADCTYLEHPLQLRSTYAEVEDCTGTRDSQXEPLVTSYNRRFKGTVDYILRSEGLQTVRVLAPIPKHAMQWTPGYPTKKWGSDHIALASEVAF 585
            +ST  S   NF   ++ N ++ + +EL  +     +  L++ + ++   T++  S WT  EI  ATG  +  +  HPL+L S+YA V+    TRDS  EPL TSY+ +F GTVDY+  S+GL   RVL  +P   +  T G P ++ GSDH+AL SE  F
Sbjct:  285 NSTPKSPLYNFLASSELNVMEHDKKELSGQKNCRPTKVLETGSKSSNTITFSFCSSWTKEEIRVATGQENSYWAAHPLKLNSSYASVKGSANTRDSVGEPLATSYHSKFLGTVDYLWYSDGLLPARVLDTLPIDVLCKTKGLPCQELGSDHLALVSEFVF 444          
BLAST of EY728612 vs. ExPASy Swiss-Prot
Match: CCR4E_ARATH (Carbon catabolite repressor protein 4 homolog 5 OS=Arabidopsis thaliana GN=CCR4-5 PE=2 SV=2)

HSP 1 Score: 100.138 bits (248), Expect = 1.819e-20
Identity = 47/105 (44.76%), Postives = 68/105 (64.76%), Query Frame = 1
Query:  274 WTPMEIATATGNADCTYLEHPLQLRSTYAEVEDCTGTRDSQXEPLVTSYNRRFKGTVDYILRSEGLQTVRVLAPIPKHAMQWTPGYPTKKWGSDHIALASEVAFV 588
            W+  E+  ATG  + T+++H L+L S Y+ V     TRD + EPL T+Y+ RF GTVDYI  ++ L  VRVL  +P   ++ T G P++ WGSDH+A+A E+ FV
Sbjct:  346 WSQEELQLATGGQETTHVQHQLKLNSAYSGVPGTYRTRDQRGEPLATTYHSRFLGTVDYIWHTKELVPVRVLETLPADVLRRTGGLPSENWGSDHLAIACELGFV 450          
The following BLAST results are available for this feature:
BLAST of EY728612 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
CCR4F_ARATH1.337e-4753.06Carbon catabolite repressor protein 4 homolog 6 OS... [more]
CCR4C_ARATH8.165e-2138.13Carbon catabolite repressor protein 4 homolog 3 OS... [more]
CCR4E_ARATH1.819e-2044.76Carbon catabolite repressor protein 4 homolog 5 OS... [more]
back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (5 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-704-006-B11-CT.F Sweet orange fruit, development stadium (5 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY728612 ID=EY728612|Name=EY728612|organism=Citrus sinensis|type=EST|length=912bp
CACGCGTCCGCGGACGCGTGGGCTAGAGAATTATCTCTTGGAAACCTAGA
TGAAACCAAGGCAGAAAGTGAAAGTATTCGTGAAGATGGTAATGCATTTT
TATTTGCATTACATAGCACTGAAGATTCCTCTCAATCAAACTTTGATCAC
TATGCACAATCAAATTTGGATCCTAATTCTGAGGAACTTGGTGATGAACT
TATTGATGACTTGTCTCCTGCCTTGGATTCTGAGGCTGTCAATGCGGAGG
AGACTACTTATAATCCATCATTATGGACACCAATGGAAATAGCAACTGCA
ACAGGGAATGCAGACTGCACCTATTTGGAACACCCTTTACAGCTTCGAAG
CACATATGCAGAAGTAGAGGATTGCACAGGGACAAGGGATTCCCAANGAG
AGCCCTTGGTGACCAGTTACAATAGACGTTTCAAGGGCACAGTTGATTAC
ATTTTGCGTTCTGAAGGTCTCCAAACAGTGAGGGTGCTTGCTCCAATACC
AAAACATGCTATGCAGTGGACACCAGGATACCCAACAAAGAAATGGGGCA
GCGATCATATTGCCTTGGCTTCTGAAGTGGCATTCGTGGAGACTATCNAA
TGATTATGCTAAAGCTATCAGAAAAAGGTTTAAGATCCCATGANTAGAGG
CCACAGATTTTCTGCCGATGATGATGTGTTGTAATTTGGTCTCTTGCTAC
ATTGTTGTATATATTATANCATTCTGCTTGTAGGTAAACAATTGAAATTT
TGCTGCAATTTTGTTTTCCCTGATCATTTACTTGAAAAACATTCTTCTTT
TTTTTTGTTGTTTCNGTGGTGATATACTGGATATAATGTTAATTGCTTCT
AACTGTTAACGATTCCTTTTACGTTGAAGGAAAAAAAAAAAAAAAAAAGG
CGGCGTTTAAGG
back to top