EY728608

Overview
NameEY728608
Unique NameEY728608
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length884
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY728608_ssr853 microsatellite EY728608_ssr853:853..864. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig895 contig Csv1_Contig895:52..936. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY728608 vs. ExPASy Swiss-Prot
Match: APRR7_ARATH (Two-component response regulator-like APRR7 OS=Arabidopsis thaliana GN=APRR7 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 7.713e-29
Identity = 100/305 (32.79%), Postives = 145/305 (47.54%), Query Frame = 2
Query:   14 KKYNGSENDSSSGDELENGSNGLSIRDGSDNGSGTQSSWTKKAAEV-DSPQPISPRYQSADDSICAQVIHTKPESFSNGWVHLNEPKDGLEQDEQPDGVAMHKGLEMQVSENADLKCDCQHEXXXXXXXXXXXIKLPEVDSKPFDNK----QLEVDNENICGKRRDQXXXXXXXXXXXXXXXXEIRDFDTPSGP-----------SDISXCQETPCLELTLKRMXGVEDDQSAANEDCNVLRHSIFSAFSKYNTASSANQGLTGNVXSCS-PLNNSSVAMKKNMQFHLIDASLTDH-GHTHTAHV 874
            K    S+ DS S DE ENGS GL+  DGS +GSG QSSWTKKA +V DSP+ +S       DS CAQV+H+ PE  SN  V     K+  E D++ + V M + LE+ +  N DL  + + E               E  S  +  K     L++ +E+   K+  +                 ++D   P  P           + +   +E   +E + KR  G +DD +   +D NVLR S  SAFS+YN AS+AN+   GN+ S S   NNS   +KK    +   +++ +   H H +HV
Sbjct:  222 KSIKKSDQDSGSSDENENGSIGLNASDGSSDGSGAQSSWTKKAVDVDDSPRAVS--LWDRVDSTCAQVVHSNPEFPSNQLVAPPAEKETQEHDDKFEDVTMGRDLEISIRRNCDLALEPKDEPLSKTTGIMRQDNSFEKSSSKWKMKVGKGPLDLSSESPSSKQMHE-----DGGSSFKAMSSHLQDNREPEAPNTHLKTLDTNEASVKISEELMHVEHSSKRHRGTKDDGTLVRDDRNVLRRSEGSAFSRYNPASNANKISGGNLGSTSLQDNNSQDLIKKTEAAYDCHSNMNESLPHNHRSHV 519          
BLAST of EY728608 vs. ExPASy Swiss-Prot
Match: PRR37_ORYSI (Two-component response regulator-like PRR37 OS=Oryza sativa subsp. indica GN=PRR37 PE=2 SV=2)

HSP 1 Score: 127.102 bits (318), Expect = 1.316e-28
Identity = 98/286 (34.27%), Postives = 141/286 (49.30%), Query Frame = 2
Query:   14 KKYNGSENDSSSGDELENGSNG----LSIRDGSDNGSGTQ--SSWTKKAAEVDSPQPISPRYQSAD--DSICAQVIHTKPESFSNGWVHLNEPKDGLEQDEQPDGVAMHKGLEMQVSENADLKCDCQHEXXXXXXXXXXXIKLPEVDSKPFDNKQLEVDNENICGKRRDQXXXXXXXXXXXXXXXXEIRDFDTPSGPSDISXCQE------TPCLELTLKRMXGVEDDQSAANED-CNVLRHSIFSAFSKYNTASSANQGLTGNVXSCSPLNNSSVAMKKNMQFHL 826
            K  +G E++++SG   ++  +G    L+ RDGSDNGSGTQ  SSWTK+A E+DSPQ +SP  Q AD  DS CAQVIH K +  SN W+     K+  +Q E  D     KG ++++    +L    Q                   +  P  N   E   EN+  +   +                  R  + P+  S +   ++       P LEL+LKR     DD +A  E+  NVLR S  SAF++Y+T  ++NQG TG V SCSP +N S AMK +  +++
Sbjct:  203 KSKSGDESNNNSGSNDDDDDDGVIMGLNARDGSDNGSGTQAQSSWTKRAVEIDSPQAMSPD-QLADPPDSTCAQVIHLKSDICSNRWLPCTSNKNSKKQKETNDD---FKGKDLEIGSPRNLNTAYQSSPNERSIK-----PTDRRNEYPLQNNSKEAAMENL-EESSVRAADLIGSMAKNMDAQQAARATNAPNCSSKVPEGKDKNRDNIMPSLELSLKRSRSTGDDANAIQEEQRNVLRRSDLSAFTRYHTPVASNQGGTGFVGSCSPHDNISEAMKTDSAYNM 478          
BLAST of EY728608 vs. ExPASy Swiss-Prot
Match: PRR37_ORYSJ (Two-component response regulator-like PRR37 OS=Oryza sativa subsp. japonica GN=PRR37 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 9.429e-27
Identity = 100/285 (35.09%), Postives = 136/285 (47.72%), Query Frame = 2
Query:   41 SSSGDELEN--GSN----------GLSIRDGSDNGSGTQ--SSWTKKAAEVDSPQPISPRYQSAD--DSICAQVIHTKPESFSNGWVHLNEPKDGLEQDEQPDGVAMHKGLEMQVSENADLKCDCQHEXXXXXXXXXXXIKLPEVDSKPFDNKQLEVDNENICGKRRDQXXXXXXXXXXXXXXXXEIRDFDTPSGPSDISXCQE------TPCLELTLKRMXGVEDDQSAANED-CNVLRHSIFSAFSKYNTASSANQGLTGNVXSCSPLNNSSVAMKKNMQFHL 826
            S SGDE  N  GSN          GL+ RDGSDNGSGTQ  SSWTK+A E+DSPQ +SP  Q AD  DS CAQVIH K +  SN W+     K+  +Q E  D     KG ++++    +L    Q                   +  P  N   E   EN+  +   +                  R  + P+  S +   ++       P LEL+LKR     D  +A  E+  NVLR S  SAF++Y+T  ++NQG TG + SCS  +NSS AMK +  +++
Sbjct:  204 SKSGDESNNNNGSNDDDDDDGVIMGLNARDGSDNGSGTQAQSSWTKRAVEIDSPQAMSPD-QLADPPDSTCAQVIHLKSDICSNRWLPCTSNKNSKKQKETNDD---FKGKDLEIGSPRNLNTAYQSSPNERSIK-----PTDRRNEYPLQNNSKEAAMENL-EESSVRAADLIGSMAKNMDAQQAARAANAPNCSSKVPEGKDKNRDNIMPSLELSLKRSRSTGDGANAIQEEQRNVLRRSDLSAFTRYHTPVASNQGGTGFMGSCSLHDNSSEAMKTDSAYNM 478          
BLAST of EY728608 vs. ExPASy Swiss-Prot
Match: PRR73_ORYSJ (Two-component response regulator-like PRR73 OS=Oryza sativa subsp. japonica GN=PRR73 PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 3.583e-26
Identity = 90/273 (32.97%), Postives = 129/273 (47.25%), Query Frame = 2
Query:   23 NGSENDSSSGDELENGSNGLSI----RDGSDNGSGTQSSWTKKAAEVDSPQPISPRYQS-ADDSICAQVIHTKPESFSNGWVHLNEPKDGLEQDEQPDGVAMHKGLEMQVSENADLKCDCQ-HEXXXXXXXXXXXIKLP------EVDSKPFDNKQLEVDNENICGKRRDQXXXXXXXXXXXXXXXXEIRDFDTPSGPSDISXCQETPCLELTLKRMXGVEDDQSAANEDCNVLRHSIFSAFSKYNTASSANQGLTGNVXSCSPLNNSSVAMK 805
            +GS ND+   D+ +   + LS+    RDGSDNGSGTQSSWTK+A E+DSPQ +SP   S   DS CAQVIH   E  SN W+     + G +  E  D  +M K LE+    N+ ++      E             +P      E DS+   N+      + I    R                  ++ D +  +  S I    E    EL LKR+       +  +++ N+L+ S  SAF++Y+T  ++NQG  G   SCSP +NSS A+K
Sbjct:  233 SGSNNDNEDDDDNDEDDDDLSVGHNARDGSDNGSGTQSSWTKRAVEIDSPQQMSPDQPSDLPDSTCAQVIHPTSEICSNRWLPTANKRSGKKHKENNDD-SMGKYLEIGAPRNSSMEYQSSPREMSVNPTEKQHETLMPQSKTTRETDSRNTQNEPTTQTVDLISSIARSTDDKQVVRINNAPDCSSKVPDGNDKNRDSLIDMTSE----ELGLKRLK-TTGSATEIHDERNILKRSDLSAFTRYHTTVASNQGGAGFGGSCSPQDNSSEALK 499          
BLAST of EY728608 vs. ExPASy Swiss-Prot
Match: PRR73_ORYSI (Two-component response regulator-like PRR73 OS=Oryza sativa subsp. indica GN=PRR73 PE=2 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 3.583e-26
Identity = 90/273 (32.97%), Postives = 129/273 (47.25%), Query Frame = 2
Query:   23 NGSENDSSSGDELENGSNGLSI----RDGSDNGSGTQSSWTKKAAEVDSPQPISPRYQS-ADDSICAQVIHTKPESFSNGWVHLNEPKDGLEQDEQPDGVAMHKGLEMQVSENADLKCDCQ-HEXXXXXXXXXXXIKLP------EVDSKPFDNKQLEVDNENICGKRRDQXXXXXXXXXXXXXXXXEIRDFDTPSGPSDISXCQETPCLELTLKRMXGVEDDQSAANEDCNVLRHSIFSAFSKYNTASSANQGLTGNVXSCSPLNNSSVAMK 805
            +GS ND+   D+ +   + LS+    RDGSDNGSGTQSSWTK+A E+DSPQ +SP   S   DS CAQVIH   E  SN W+     + G +  E  D  +M K LE+    N+ ++      E             +P      E DS+   N+      + I    R                  ++ D +  +  S I    E    EL LKR+       +  +++ N+L+ S  SAF++Y+T  ++NQG  G   SCSP +NSS A+K
Sbjct:  233 SGSNNDNEDDDDNDEDDDDLSVGHNARDGSDNGSGTQSSWTKRAVEIDSPQQMSPDQPSDLPDSTCAQVIHPTSEICSNRWLPTANKRSGKKHKENNDD-SMGKYLEIGAPRNSSMEYQSSPREMSVNPTEKQHETLMPQSKTTRETDSRNTQNEPTTQTVDLISSIARSTDDKQVVRINNAPDCSSKVPDGNDKNRDSLIDMTSE----ELGLKRLK-TTGSATEIHDERNILKRSDLSAFTRYHTTVASNQGGAGFGGSCSPQDNSSEALK 499          
BLAST of EY728608 vs. ExPASy Swiss-Prot
Match: APRR3_ARATH (Two-component response regulator-like APRR3 OS=Arabidopsis thaliana GN=APRR3 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.733e-16
Identity = 82/258 (31.78%), Postives = 115/258 (44.57%), Query Frame = 2
Query:   26 GSENDSSSGDELEN---GSNGLSIRDG-SDNGSGTQSSWTKKAAEVDSPQPISPRYQSADDSICAQVIHTKPESFSNGWVHLNEPKDGLEQDEQPDGVAMHKGLEM--QVSENADLKCDCQHEXXXXXXXXXXXIKLPEVDSKPFDNKQLEVDNENICGKRRDQXXXXXXXXXXXXXXXXEIRDFDTPSGPSDISXCQETPCLELTLKRMXGVEDDQSAANEDCNVLRHSIFSAFSKYNT-ASSANQGLTGNVXSCSP 778
            GSEND+S  DE  N    S GLS +DG SDNGSGTQSSWTK+A++  S  P S ++  A +         K  ++ NG  H+N  K+  +Q EQ  G     G+ M  +  E  DL+ + ++                         + LE +N++   +                       +   PS     S  ++   LE TLK+     +D+     D +VLRHS  SAFSKYN  A+SA +    NV SCSP
Sbjct:  211 GSENDASISDEHRNESGSSGGLSNQDGGSDNGSGTQSSWTKRASDTKSTSP-SNQFPDAPN---------KKGTYENGCAHVNRLKEAEDQKEQ-IGTGSQTGMSMSKKAEEPGDLEKNAKYSV-----------------------QALERNNDDTLNRSSGNSQV----------------ESKAPS-----SNREDLQSLEQTLKK---TREDRDYKVGDRSVLRHSNLSAFSKYNNGATSAKKAPEENVESCSP 410          
The following BLAST results are available for this feature:
BLAST of EY728608 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
APRR7_ARATH7.713e-2932.79Two-component response regulator-like APRR7 OS=Ara... [more]
PRR37_ORYSI1.316e-2834.27Two-component response regulator-like PRR37 OS=Ory... [more]
PRR37_ORYSJ9.429e-2735.09Two-component response regulator-like PRR37 OS=Ory... [more]
PRR73_ORYSJ3.583e-2632.97Two-component response regulator-like PRR73 OS=Ory... [more]
PRR73_ORYSI3.583e-2632.97Two-component response regulator-like PRR73 OS=Ory... [more]
APRR3_ARATH5.733e-1631.78Two-component response regulator-like APRR3 OS=Ara... [more]
back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (5 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-704-006-B05-CT.F Sweet orange fruit, development stadium (5 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY728608 ID=EY728608|Name=EY728608|organism=Citrus sinensis|type=EST|length=884bp
CACGCGTCCGGTCAAAAAGTACAACGGCTCTGAAAATGATAGCAGCAGCG
GTGATGAGCTTGAGAATGGGAGTAATGGTCTGAGTATTCGAGATGGAAGT
GACAATGGGAGTGGCACTCAGAGTTCATGGACCAAAAAGGCAGCTGAAGT
CGACAGCCCCCAACCAATATCACCCCGGTATCAATCGGCTGATGATAGCA
TTTGTGCCCAGGTGATTCATACTAAGCCTGAATCATTTAGCAATGGGTGG
GTGCATCTTAATGAACCAAAAGATGGTCTTGAGCAGGATGAACAACCTGA
TGGTGTTGCAATGCACAAAGGATTGGAAATGCAAGTATCTGAAAATGCAG
ATTTAAAATGTGATTGTCAACATGAGAAGAAATCTACGCAGCAAACTAGC
AAAAAGAAGATTAAATTGCCGGAAGTAGATAGTAAGCCATTTGATAATAA
GCAACTGGAGGTTGACAATGAAAATATATGTGGCAAACGAAGAGATCAGG
CTACTAGCACATCAAGTGCAAACGCCAATCATGCTAATCCCCATGCTGAA
ATCAGAGATTTTGACACTCCAAGTGGCCCTTCTGATATATCACNTTGTCA
AGAAACACCATGCCTGGAACTAACTTTGAAAAGGATGCANGGAGTGGAAG
ATGATCAAAGTGCTGCAAATGAAGATTGCAATGTGTTGAGACATTCAATT
TTTTCTGCATTCTCAAAATACAATACTGCGTCTTCAGCAAATCAGGGTCT
CACTGGGAATGTANGAAGCTGTTCTCCTCTAAATAACAGCTCTGTGGCAA
TGAAAAAGAACATGCAATTTCATCTCATCGATGCATCTCTCACGGATCAT
GGACACACACACACTGCTCATGTATATTACCCAG
back to top