EY728607

Overview
NameEY728607
Unique NameEY728607
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length874
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig154 contig Csv1_Contig154:110..983. BLAST: Citrus Unigene V1 Contigs to Populus V2 proteins
Homology
BLAST of EY728607 vs. ExPASy Swiss-Prot
Match: PFPI_PYRHO (Intracellular protease 1 OS=Pyrococcus horikoshii GN=pfpI PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.349e-22
Identity = 48/113 (42.48%), Postives = 76/113 (67.26%), Query Frame = 3
Query:  120 TYSETRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIIT 458
            T +   G++  ++ TFD+++P ++D LV+PGGRAPE + +N+  + + RK  + GK +ASICHG  IL +A V++GRK T+YP +K  +I AG  W++ E     VVDGN ++
Sbjct:   39 TITGKHGYSVKVDLTFDKVNPEEFDALVLPGGRAPERVRLNEKAVSIARKMFSEGKPVASICHGPQILISAGVLRGRKGTSYPGIKDDMINAGVEWVDAEV----VVDGNWVS 147          
BLAST of EY728607 vs. ExPASy Swiss-Prot
Match: PFPI_PYRFU (Intracellular protease 1 OS=Pyrococcus furiosus GN=pfpI PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.166e-21
Identity = 54/140 (38.57%), Postives = 83/140 (59.29%), Query Frame = 3
Query:  111 GHQTYSET---------RGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIIT----GGYYEGHPEFI 491
            GH+ Y  +          G++  ++ TFDE++P ++D LV+PGGRAPE + +N+  +++ RK    GK +A+ICHG  IL +A V+KGRK T+Y  ++  +I AG  WI+ E     VVDGN ++    G  Y    EF+
Sbjct:   27 GHEVYIASFEKGVITGKHGYSVKVDLTFDEVNPDEFDALVLPGGRAPERVRLNEKAVEIARKMFTEGKPVATICHGPQILISAGVLKGRKGTSYIGIRDDMINAGVEWIDREV----VVDGNWVSSRHPGDLYAWMREFV 162          
BLAST of EY728607 vs. ExPASy Swiss-Prot
Match: PFPI_PYRAB (Intracellular protease 1 OS=Pyrococcus abyssi GN=pfpI PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.392e-21
Identity = 48/122 (39.34%), Postives = 78/122 (63.93%), Query Frame = 3
Query:  138 GHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIIT----GGYYEGHPEFI 491
            G+   ++  F+E++P ++D LV+PGGRAPE + +N+  +++ +K  + GK +ASICHG  IL +A V++GR+ T+YP +K  +I AG  W++ E     VVDGN ++    G  Y    EF+
Sbjct:   45 GYTVNVDLAFEEVNPDEFDALVLPGGRAPERVRLNEKAVEIAKKMFSEGKPVASICHGPQILISAGVLRGRRGTSYPGIKDDMINAGVDWVDAEV----VVDGNWVSSRVPGDLYAWMREFV 162          
BLAST of EY728607 vs. ExPASy Swiss-Prot
Match: PFPI_PYRKO (Intracellular protease 1 OS=Pyrococcus kodakaraensis GN=pfpI PE=3 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.872e-20
Identity = 57/140 (40.71%), Postives = 81/140 (57.86%), Query Frame = 3
Query:  111 GHQTY--SETRG-----HNFALNA--TFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIIT----GGYYEGHPEFI 491
            GH+ Y  S  RG     H + +N    FDE+DP ++D LV+PGGRAPE + +N+  + + +K    GK +ASICHG  IL +A V+KGRK T+   ++  +  AGA WI+ E     VVDGN ++    G  Y    EF+
Sbjct:   27 GHEVYVASFQRGKITGKHGYTVNVDLAFDEVDPDEFDALVLPGGRAPEIVRLNEKAVAITKKMFEDGKPVASICHGPQILISAGVLKGRKGTSTVTIRDDVKNAGAEWIDAEV----VVDGNWVSSRHPGDLYAWMREFV 162          
BLAST of EY728607 vs. ExPASy Swiss-Prot
Match: Y1281_ARCFU (Uncharacterized protein AF_1281 OS=Archaeoglobus fulgidus GN=AF_1281 PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.275e-17
Identity = 46/126 (36.51%), Postives = 76/126 (60.32%), Query Frame = 3
Query:  135 RGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGGYYEGHPEFIXAFLKAL 512
            +G+    + T++++    Y GLVIPGG++PE + +N+  +++V+ F   GK +A+ICHG  +L +A  VKGR+ T++  ++  LIAAGA + +       VVDGN+IT    +  P F    +K L
Sbjct:   44 KGYQVRPDLTYEDVKVEDYAGLVIPGGKSPERVRINERAVEIVKDFLELGKPVAAICHGPQLLISAMAVKGRRMTSWIGIRDDLIAAGALYED----RPVVVDGNVITSRMPDDLPYFCGELIKIL 165          
BLAST of EY728607 vs. ExPASy Swiss-Prot
Match: YHBO_ECOLI (Protein yhbO OS=Escherichia coli (strain K12) GN=yhbO PE=1 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 2.782e-15
Identity = 42/121 (34.71%), Postives = 70/121 (57.85%), Query Frame = 3
Query:  153 LNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGGYYEGHPEFIXAFLKALG 515
            ++ + DE+ P ++D L++PGG +P+YL  ++  +   R F NSGK + +ICHG  +L +ADV++GRK TA  P+   +  AGA + + E +   V    ++T    +  P F    L+ LG
Sbjct:   54 IDKSIDEVTPAEFDALLLPGGHSPDYLRGDNRFVTFTRDFVNSGKPVFAICHGPQLLISADVIRGRKLTAVKPIIIDVKNAGAEFYDQEVV---VDKDQLVTSRTPDDLPAFNREALRLLG 171          
BLAST of EY728607 vs. ExPASy Swiss-Prot
Match: Y967_METJA (Uncharacterized protein MJ0967 OS=Methanocaldococcus jannaschii GN=MJ0967 PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.866e-11
Identity = 47/136 (34.56%), Postives = 74/136 (54.41%), Query Frame = 3
Query:   87 PTAVHQSTGHQT--YSETRG-------HNFALNATFDEIDPTKYDGLVIPGG-RAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPV--LIAAGASWIEPETMAACVVDGNIIT 458
            P AV +S G +    S T+G       +   +  T  +++P  Y  +VI GG  + EYL  N  +I+LV++F N  K +++IC   ++LA A ++KG+K T YP  + +  L  AGA + +       VVDGN+IT
Sbjct:   51 PMAVFESNGLKVDVVSTTKGECVGMLGNKITVEKTIYDVNPDDYVAIVIVGGIGSKEYLWNNTKLIELVKEFYNKNKVVSAICLSPVVLARAGILKGKKATVYPAPEAIEELKKAGAIYED----RGVVVDGNVIT 182          
BLAST of EY728607 vs. ExPASy Swiss-Prot
Match: YRAA_BACSU (Putative cysteine protease yraA OS=Bacillus subtilis GN=yraA PE=2 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 7.090e-11
Identity = 34/107 (31.78%), Postives = 59/107 (55.14%), Query Frame = 3
Query:  138 GHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIIT 458
            G    ++    ++D + +D L+IPGG +P+ L  +D   +  + F  + K + +ICHG  +L   D++KG+  T Y  ++  LI AGA++ + E     VV  NI+T
Sbjct:   48 GEKVKIDKAISDVDASDFDALLIPGGFSPDLLRADDRPGEFAKAFVENKKPVFAICHGPQVLIDTDLLKGKDITGYRSIRKDLINAGANYKDAEV----VVSHNIVT 150          
The following BLAST results are available for this feature:
BLAST of EY728607 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
PFPI_PYRHO2.349e-2242.48Intracellular protease 1 OS=Pyrococcus horikoshii ... [more]
PFPI_PYRFU1.166e-2138.57Intracellular protease 1 OS=Pyrococcus furiosus GN... [more]
PFPI_PYRAB3.392e-2139.34Intracellular protease 1 OS=Pyrococcus abyssi GN=p... [more]
PFPI_PYRKO2.872e-2040.71Intracellular protease 1 OS=Pyrococcus kodakaraens... [more]
Y1281_ARCFU2.275e-1736.51Uncharacterized protein AF_1281 OS=Archaeoglobus f... [more]
YHBO_ECOLI2.782e-1534.71Protein yhbO OS=Escherichia coli (strain K12) GN=y... [more]
Y967_METJA1.866e-1134.56Uncharacterized protein MJ0967 OS=Methanocaldococc... [more]
YRAA_BACSU7.090e-1131.78Putative cysteine protease yraA OS=Bacillus subtil... [more]
back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (5 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-704-006-B04-CT.F Sweet orange fruit, development stadium (5 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY728607 ID=EY728607|Name=EY728607|organism=Citrus sinensis|type=EST|length=874bp
CACGCGTCCGGCCTTTTCAAGCATTACTGGCTTTCGGAGTCTCAGTTGAC
GCCGCGTGTCCCGGAAAGAAATCCGGTGATGTTTGCCCCACTGCAGTTCA
TCAATCGACTGGTCATCAGACATATTCCGAGACACGTGGTCACAATTTCG
CACTCAATGCGACATTTGATGAAATTGACCCGACCAAATATGATGGCTTG
GTCATACCAGGAGGAAGAGCTCCAGAATATCTTGCTATGAATGATTCTGT
GATTGACTTAGTGAGAAAATTCTCCAACTCGGGCAAAACAATTGCTTCCA
TTTGCCATGGGCAGTTAATATTGGCAGCTGCTGATGTGGTCAAAGGTCGA
AAGTGCACAGCATATCCTCCTGTGAAACCTGTGCTTATTGCCGCTGGTGC
TTCTTGGATTGAGCCAGAGACCATGGCAGCTTGTGTTGTTGATGGTAACA
TCATTACTGGGGGCTACTACGAGGGTCATCCTGAGTTCATTCNGGCTTTT
CTTAAAGCACTGGGTGGCACCATAACTGGTTCTGATAAGAGAATNNCTTT
TCTTTGTGGGGATTACTTGGAAAGATATGAGGTANCTGTNCCTTTTCAGT
CCCTTCAGGCACTAAAGTGCCATGTTGATGCTGTATGCCCCAAAAAAAAG
GCTGGGGACTCCTGCCCCACTGCTGTTCATGATTTTGAAGGTGATCAAAC
TTACAGCGAGAAACCCAGGCCATATTTCACCCTAACTGCGAACTTTGAAA
GTGTTGATGTGTCGGGCTATAATGCTCTTGTTGTCCCTGGAAGTCAACCC
CCAAAATTCCGGCCCCAAAATAAAATGAATTGGCTTAATGAAGGATTTAT
GGAGGGCGAAAAACCAGTTGCCTC
back to top