EY728235

Overview
NameEY728235
Unique NameEY728235
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length925
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY728235 vs. ExPASy Swiss-Prot
Match: IFRH_SOLTU (Isoflavone reductase homolog OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 4.152e-73
Identity = 154/247 (62.35%), Postives = 183/247 (74.09%), Query Frame = 3
Query:   60 MASKSKILFIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSAPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPT*G*SCLLRRWKS*SCL*QGR*YLGPILSRG**SQNLKKSLTLNPLGNLL-IHDFVSLGERKLA-NPSKGDLPEEQ 794
            MA KSKILFIGGTGYIGKFIVEAS KAGH TFVLVRESTLS P+K++L+D FK  GV  V GD+ +HESLVKAIKQVDVVISTVGH LL DQVK+IAAIKEAGN+KRFFPSEFGNDVDRVHAVEPAK+AF TKA+IRR VEAEGIP+TYVA+ FFA Y LPNL+QPGA  P      +L    + +   +        ++     + L K L + P  N++ +++ VSL E+K   N  +  +PEEQ
Sbjct:    1 MAGKSKILFIGGTGYIGKFIVEASAKAGHDTFVLVRESTLSNPTKTKLIDTFKSFGVTFVHGDLYDHESLVKAIKQVDVVISTVGHALLADQVKLIAAIKEAGNVKRFFPSEFGNDVDRVHAVEPAKAAFNTKAQIRRVVEAEGIPFTYVATFFFAGYSLPNLAQPGAAGPPNDKVVILGHGNTKAVFNKEEDIGTYTINAVDDPKTLNKILYIKPPHNIITLNELVSLWEKKTGKNLERLYVPEEQ 247          
BLAST of EY728235 vs. ExPASy Swiss-Prot
Match: IFRH_TOBAC (Isoflavone reductase homolog A622 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 1.770e-69
Identity = 116/172 (67.44%), Postives = 132/172 (76.74%), Query Frame = 3
Query:   57 VMASKSKILFIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSAPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAP 572
            V++ KSKIL IGGTGYIGK++VE S K+GHPTF L+RESTL  P KS+L+D FK  GV L+ GD+ N ESL+KAIKQVDVVISTVG     DQV II AIKEAGNIKRF PSEFG DVD   A+EPA S FA K +IRR +EAEGIPYTYV  N+FA +FLPNL Q  A  P
Sbjct:    2 VVSEKSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVTLLFGDISNQESLLKAIKQVDVVISTVGGQQFTDQVNIIKAIKEAGNIKRFLPSEFGFDVDHARAIEPAASLFALKVRIRRMIEAEGIPYTYVICNWFADFFLPNLGQLEAKTP 173          

HSP 2 Score: 55.4546 bits (132), Expect = 1.770e-69
Identity = 32/70 (45.71%), Postives = 40/70 (57.14%), Query Frame = 1
Query:  571 PPRDKVASLGDGNPKAVYNKGDDIWDLYYQGGDDPRTLKNPLH-*TPWEIYSFMTLCR-WGKENWQTLQR 774
            PPRDKV   GDGNPKA+Y K +DI     +  DDPRTL   LH   P  I SF  +   W  +  +TL++
Sbjct:  173 PPRDKVVIFGDGNPKAIYVKEEDIATYTIEAVDDPRTLNKTLHMRPPANILSFNEIVSLWEDKIGKTLEK 242          
BLAST of EY728235 vs. ExPASy Swiss-Prot
Match: IFRH_ARATH (Isoflavone reductase homolog P3 OS=Arabidopsis thaliana GN=At1g75280 PE=1 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 8.981e-60
Identity = 136/255 (53.33%), Postives = 167/255 (65.49%), Query Frame = 3
Query:   69 KSKILFIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSAPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQ--PGATAPT*G*SCLLRRWKS*SCL*QGR*YLGPILSRG**SQNLKKSLTLNPLGNLL-IHDFVSLGERKLANP-SKGDLPEEQS*KYSKAGP 821
            KSKIL IGGTGYIGKF+VEAS KAGH TF LVRE+TLS P K + +  FK LGV ++ GD+ +HESLVKAIKQVDVVISTVG   + DQ KII+AIKEAGN+KRF PSEFG DVDR  AVEPAKSAFA K +IRR +EAEGIPYTY  +  F  Y+LP L Q  PG T+P      +L    + + + +        +      + L K L + P  N L +++ V+L E+K+     K  LPEEQ  K  +  P
Sbjct:    5 KSKILVIGGTGYIGKFLVEASAKAGHSTFALVREATLSDPVKGKTVQSFKDLGVTILHGDLNDHESLVKAIKQVDVVISTVGSMQILDQTKIISAIKEAGNVKRFLPSEFGVDVDRTSAVEPAKSAFAGKIQIRRTIEAEGIPYTYAVTGCFGGYYLPTLVQFEPGLTSPPRDKVTILGDGNAKAVINKEEDIAAYTIKAVDDPRTLNKILYIKPSNNTLSMNEIVTLWEKKIGKSLEKTHLPEEQLLKSIQESP 259          
BLAST of EY728235 vs. ExPASy Swiss-Prot
Match: IFR_MEDSA (Isoflavone reductase OS=Medicago sativa GN=IFR PE=1 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 2.209e-54
Identity = 100/182 (54.95%), Postives = 131/182 (71.98%), Query Frame = 3
Query:   60 MASKSKILFIGGTGYIGKFIVEASVKAGHPTFVLVRES----------TLSAP-SKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAP 572
            MA+++KIL +G TG IG+ IV AS+KAG+PT+ LVR++          T + P +K +L+D+++ LGV L+ GD+ +HE+LVKAIKQVD+VI   G  L+ DQVKII AIKEAGN+K+FFPSEFG DVDR  AVEP +  F  KA IRR +EAEG+PYTY+  + F  YFL NL+Q   T P
Sbjct:    1 MATENKILILGPTGAIGRHIVWASIKAGNPTYALVRKTPGNVNKPKLITAANPETKEELIDNYQSLGVILLEGDINDHETLVKAIKQVDIVICAAGRLLIEDQVKIIKAIKEAGNVKKFFPSEFGLDVDRHEAVEPVRQVFEEKASIRRVIEAEGVPYTYLCCHAFTGYFLRNLAQLDTTDP 182          

HSP 2 Score: 43.5134 bits (101), Expect = 2.209e-54
Identity = 25/70 (35.71%), Postives = 34/70 (48.57%), Query Frame = 1
Query:  571 PPRDKVASLGDGNPKAVYNKGDDIWDLYYQGGDDPRTLKNPLH*TPWEIYSFM--TLCRWGKENWQTLQR 774
            PPRDKV  LGDGN K  Y    D+     +  +DP TL   +H    E Y      +  W K+  +TL++
Sbjct:  182 PPRDKVVILGDGNVKGAYVTEADVGTFTIRAANDPNTLNKAVHIRLPENYLTQNEVIALWEKKIGKTLEK 251          
BLAST of EY728235 vs. ExPASy Swiss-Prot
Match: IFR_CICAR (Isoflavone reductase OS=Cicer arietinum GN=IFR PE=1 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 1.842e-53
Identity = 101/182 (55.49%), Postives = 127/182 (69.78%), Query Frame = 3
Query:   60 MASKSKILFIGGTGYIGKFIVEASVKAGHPTFVLVRES-----------TLSAPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAP 572
            MAS+++IL +G TG IG+ +V AS+KAG+PT+ L+R++             +  SK +LL  FK  GV L+ GD+ +HE+LVKAIKQVD VI T G  L+ DQVKII AIKEAGN+KRFFPSEFG DVDR  AV+P +  F  KA IRR VEAEG+PYTY+  + F  YFL NL+Q  AT P
Sbjct:    1 MASQNRILVLGPTGAIGRHVVWASIKAGNPTYALIRKTPGDINKPSLVAAANPESKEELLQSFKAAGVILLEGDMNDHEALVKAIKQVDTVICTFGRLLILDQVKIIKAIKEAGNVKRFFPSEFGLDVDRHDAVDPVRPVFDEKASIRRVVEAEGVPYTYLCCHAFTGYFLRNLAQFDATEP 182          

HSP 2 Score: 43.1282 bits (100), Expect = 1.842e-53
Identity = 20/43 (46.51%), Postives = 24/43 (55.81%), Query Frame = 1
Query:  571 PPRDKVASLGDGNPKAVYNKGDDIWDLYYQGGDDPRTLKNPLH 699
            PPRDKV  LGDGN K  Y    D+     +  +DPRTL   +H
Sbjct:  182 PPRDKVIILGDGNVKGAYVTEADVGTYTIRAANDPRTLNKAVH 224          
BLAST of EY728235 vs. ExPASy Swiss-Prot
Match: IFR_PEA (Isoflavone reductase OS=Pisum sativum GN=IFR PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 9.825e-52
Identity = 97/182 (53.30%), Postives = 127/182 (69.78%), Query Frame = 3
Query:   60 MASKSKILFIGGTGYIGKFIVEASVKAGHPTFVLVREST-----------LSAPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAP 572
            MA+++KIL +G TG IG+ IV AS+KAG+PT+ LVR+++            +  +K +LL +++  GV L+ GD+ +HE+LV AIKQVD VI   G  L+ DQVK+I AIKEAGN+KRFFPSEFG DVDR  AVEP +  F  KA IRR VE+EG+PYTY+  + F  YFL NL+Q  AT P
Sbjct:    1 MATENKILILGATGAIGRHIVWASIKAGNPTYALVRKTSDNVNKPKLTEAANPETKEELLKNYQASGVILLEGDINDHETLVNAIKQVDTVICAAGRLLIEDQVKVIKAIKEAGNVKRFFPSEFGLDVDRHDAVEPVRQVFEEKASIRRVVESEGVPYTYLCCHAFTGYFLRNLAQIDATDP 182          

HSP 2 Score: 40.4318 bits (93), Expect = 9.825e-52
Identity = 18/43 (41.86%), Postives = 23/43 (53.49%), Query Frame = 1
Query:  571 PPRDKVASLGDGNPKAVYNKGDDIWDLYYQGGDDPRTLKNPLH 699
            PPRDKV  LGDGN +  Y    D+     +  +DP TL   +H
Sbjct:  182 PPRDKVVILGDGNVRGAYVTEADVGTYTIRAANDPNTLNKAVH 224          
BLAST of EY728235 vs. ExPASy Swiss-Prot
Match: IFRH_MAIZE (Isoflavone reductase homolog IRL OS=Zea mays GN=IRL PE=2 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 8.897e-50
Identity = 92/170 (54.12%), Postives = 116/170 (68.24%), Query Frame = 3
Query:   63 ASKSKILFIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSAPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAP 572
            + KSKIL +GGTGY+G+ +V AS + GHPT  LVR++  S P+K+ LL  F+  GV L+ GD+ +  SLV A+K  DVVIS +G   + DQ +++ AIKEAGN+KRFFPSEFG DVDR   VEPAKS    K  IRRA EA GIPYTY  + FFA + LP + Q  A  P
Sbjct:    3 SEKSKILVVGGTGYLGRHVVAASARLGHPTSALVRDTAPSDPAKAALLKSFQDAGVTLLKGDLYDQASLVSAVKGADVVISVLGSMQIADQSRLVDAIKEAGNVKRFFPSEFGLDVDRTGIVEPAKSILGAKVGIRRATEAAGIPYTYAVAGFFAGFGLPKVGQVLAPGP 172          

HSP 2 Score: 36.5798 bits (83), Expect = 8.897e-50
Identity = 24/70 (34.29%), Postives = 32/70 (45.71%), Query Frame = 1
Query:  571 PPRDKVASLGDGNPKAVYNKGDDIWDLYYQGGDDPRTLKNPLH*TP--WEIYSFMTLCRWGKENWQTLQR 774
            PP DK   LGDG+ KAV+ +  DI        DDPR     L+  P    +     L  W K+  +T +R
Sbjct:  172 PPADKAVVLGDGDTKAVFVEEGDIATYTVLAADDPRAENKVLYIKPPANTLSHNELLSLWEKKTGKTFRR 241          
BLAST of EY728235 vs. ExPASy Swiss-Prot
Match: IFRH_LUPAL (Isoflavone reductase homolog OS=Lupinus albus PE=2 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 2.047e-42
Identity = 85/175 (48.57%), Postives = 112/175 (64.00%), Query Frame = 3
Query:   69 KSKILFIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSAPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTV------GHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRV-HAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAP 572
            KSK+L +GGTGY+G+ IV+AS++ GH TF+L R        K Q+L  FKK G  LV     +H+SLV A+K VDVVI T+       H LL  Q+K++ AIK+AGNIKRF PSEFG D   + HA+EP +  F  K  +R+A+E   IP+TY+++N FA YF  NLSQ     P
Sbjct:    3 KSKVLVVGGTGYVGRRIVKASLEHGHETFILQRPEIGLDIEKLQILLSFKKQGAILVEASFSDHKSLVDAVKLVDVVICTMSGVHFRSHNLL-TQLKLVEAIKDAGNIKRFLPSEFGMDPALMGHALEPGRVTFDEKMTVRKAIEEANIPFTYISANCFAGYFAGNLSQMKTLLP 176          

HSP 2 Score: 44.2838 bits (103), Expect = 2.047e-42
Identity = 24/50 (48.00%), Postives = 28/50 (56.00%), Query Frame = 1
Query:  565 LPPPRDKVASLGDGNPKAVYNKGDDIWDLYYQGGDDPRTLKNPLH*TPWE 714
            L PPRDKV   GDGN K VY   DD+     +  DDPRTL   ++  P E
Sbjct:  174 LLPPRDKVLLYGDGNVKPVYMDEDDVATYTIKTIDDPRTLNKTVYLRPPE 223          
BLAST of EY728235 vs. ExPASy Swiss-Prot
Match: IGS1_PETHY (Isoeugenol synthase 1 OS=Petunia hybrida GN=IGS1 PE=1 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.841e-40
Identity = 83/164 (50.61%), Postives = 110/164 (67.07%), Query Frame = 3
Query:   69 KSKILFIGGTGYIGKFIVEASVKAGHPTFVLVRE-STLSAPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQP 557
            K KIL +G TGY+GK++V+AS+  GHPT+  V      S  SK QLL  F+ LGV +  G++  H+ LV   K+VD+VIST+      +Q+K+I AIKEAGNIKRF PSEFGN+VDRV A+   ++    K KIRRA EA GIP+T+V++N   AYF+  L  P
Sbjct:    5 KGKILILGATGYLGKYMVKASISLGHPTYAYVMPLKKNSDDSKLQLLKEFESLGVTIFYGELSEHDKLVAVFKEVDIVISTLAVPQYLEQLKVIEAIKEAGNIKRFVPSEFGNEVDRVRALPRFQAVLDNKKKIRRATEAAGIPFTFVSANSLTAYFVDYLLHP 168          

HSP 2 Score: 26.9498 bits (58), Expect = 1.841e-40
Identity = 13/39 (33.33%), Postives = 19/39 (48.72%), Query Frame = 1
Query:  580 DKVASLGDGNPKAVYNKGDDIWDLYYQGGDDPRTLKNPL 696
            ++V   G G+ KAV N  +D+     +  DDPR     L
Sbjct:  173 EQVTIYGSGDAKAVLNYEEDVAAYTIKAADDPRAANRVL 211          
BLAST of EY728235 vs. ExPASy Swiss-Prot
Match: EGS1_OCIBA (Eugenol synthase 1 OS=Ocimum basilicum GN=EGS1 PE=1 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 1.993e-39
Identity = 83/163 (50.92%), Postives = 113/163 (69.33%), Query Frame = 3
Query:   69 KSKILFIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSAPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQP 557
            KSKIL  GGTGYIG  +V+ S+K GHPT+V  R ++    SK+ LLD F+ LG  +V G++  HE LV+ +K+VDVVIS +    + DQ KI+ AIK AGNIKRF PS+FG + DR++A+ P ++    K  IRRA+E   IPYTYV++N FA+YF+  L +P
Sbjct:    7 KSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNS----SKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFGVEEDRINALPPFEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRP 165          

HSP 2 Score: 23.8682 bits (50), Expect = 1.993e-39
Identity = 17/62 (27.42%), Postives = 24/62 (38.71%), Query Frame = 1
Query:  574 PRDKVASLGDGNPKAVYNKGDDIWDLYYQGGDDPRTLKNPLH*TPWE--IYSFMTLCRWGKE 753
            P+D++   G G  K   N   DI     +   DPR L   +   P    I     + RW K+
Sbjct:  168 PKDEITVYGTGEAKFAMNYEQDIGLYTIKVATDPRALNRVVIYRPSTNIITQLELISRWEKK 229          
The following BLAST results are available for this feature:
BLAST of EY728235 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
IFRH_SOLTU4.152e-7362.35Isoflavone reductase homolog OS=Solanum tuberosum ... [more]
IFRH_TOBAC1.770e-6967.44Isoflavone reductase homolog A622 OS=Nicotiana tab... [more]
IFRH_ARATH8.981e-6053.33Isoflavone reductase homolog P3 OS=Arabidopsis tha... [more]
IFR_MEDSA2.209e-5454.95Isoflavone reductase OS=Medicago sativa GN=IFR PE=... [more]
IFR_CICAR1.842e-5355.49Isoflavone reductase OS=Cicer arietinum GN=IFR PE=... [more]
IFR_PEA9.825e-5253.30Isoflavone reductase OS=Pisum sativum GN=IFR PE=2 ... [more]
IFRH_MAIZE8.897e-5054.12Isoflavone reductase homolog IRL OS=Zea mays GN=IR... [more]
IFRH_LUPAL2.047e-4248.57Isoflavone reductase homolog OS=Lupinus albus PE=2... [more]
IGS1_PETHY1.841e-4050.61Isoeugenol synthase 1 OS=Petunia hybrida GN=IGS1 P... [more]
EGS1_OCIBA1.993e-3950.92Eugenol synthase 1 OS=Ocimum basilicum GN=EGS1 PE=... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (5 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-704-001-C02-CT.F Sweet orange fruit, development stadium (5 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY728235 ID=EY728235|Name=EY728235|organism=Citrus sinensis|type=EST|length=925bp
CCACGCGTCCGGGAAAAAAAGGAAAGAATCCCCGAAATTGAACTGAACAA
GTCTCGGTAATGGCGTCGAAAAGCAAGATTCTATTCATCGGTGGGACAGG
GTACATCGGCAAATTCATCGTCGAAGCGAGCGTGAAAGCCGGCCACCCGA
CGTTCGTGCTCGTGAGAGAATCCACACTCTCCGCTCCTTCCAAATCTCAG
CTCCTCGATCACTTCAAAAAACTCGGCGTCAATCTCGTCATCGGAGATGT
GTTGAATCACGAGAGCTTGGTGAAGGCGATAAAACAAGTGGACGTGGTGA
TATCAACGGTCGGTCACACTTTATTAGGTGATCAGGTCAAGATTATTGCG
GCCATTAAAGAAGCTGGTAACATTAAGAGATTCTTCCCTTCAGAATTTGG
GAATGATGTTGATCGAGTCCATGCCGTTGAGCCAGCAAAATCAGCATTTG
CCACAAAGGCGAAAATCCGCCGAGCCGTTGAGGCTGAAGGGATTCCGTAT
ACTTATGTAGCGTCGAATTTCTTTGCTGCTTACTTCCTTCCCAATTTGTC
GCAGCCCGGGGCCACTGCCCCCACCTAGGGATAAAGTTGCCTCCTTAGGC
GATGGAAATCCTAAAGCTGTTTATAACAAGGGAGATGATATTTGGGACCT
ATACTATCAAGGGGGTGATGATCCCAGAACCTTAAAAAATCCCTTACATT
AAACCCCCTGGGAAATTTACTCATTCATGACTTTGTGTCGTTGGGGGAAA
GAAAATTGGCAAACCCTTCAAAGGGGGACCTTCCGGAGGAGCAGTCCTAA
AAATATTCAAAAGCTGGCCCTCCGTTATGTGATTTTTCATTCCCACTCCG
CTTCGGAAGGAAAACAACCACTTCAAATTGACCATCTTTGGAGTTAACCT
CCCGTTTTTCCCAAGTAATGCCCTC
back to top