EY728231

Overview
NameEY728231
Unique NameEY728231
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length905
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5972 contig Csv1_Contig5972:139..1043. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY728231 vs. ExPASy Swiss-Prot
Match: CRK35_ARATH (Putative cysteine-rich receptor-like protein kinase 35 OS=Arabidopsis thaliana GN=CRK35 PE=3 SV=2)

HSP 1 Score: 235.343 bits (599), Expect = 3.506e-61
Identity = 118/196 (60.20%), Postives = 151/196 (77.04%), Query Frame = 1
Query:  244 FSFSSVSSATGNFSAANKLGEGGFGTVYKGVIGQG-EIAVKRLLGKSGQEIKELKNEASVIAQVQHKNLVKLLGCCIEKDERLLIYEYMPNKSLDCFLFDPTKREILDWRTRVQIIKGVAQGLLYLHQYSRVRIIHRDLKASNILLDKDMNPKISDFGMARIVFGGNDXDELXXHTSXISGTYGYMSPEYALEGIF 828
            FSF ++ +AT  FS +N +G GGFG VY+G +  G E+AVKRL   SGQ  +E KNEA +++++QHKNLV+LLG C+E +E++L+YE++PNKSLD FLFDP K+  LDW  R  II G+A+G+LYLHQ SR+ IIHRDLKASNILLD DMNPKI+DFGMARI FG    D+   +T  I+GT+GYMSPEYA+ G F
Sbjct:  333 FSFKTIEAATDKFSDSNMIGRGGFGEVYRGKLSSGPEVAVKRLSKTSGQGAEEFKNEAVLVSKLQHKNLVRLLGFCLEGEEKILVYEFVPNKSLDYFLFDPAKQGELDWTRRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGMARI-FG---VDQSQANTRRIAGTFGYMSPEYAMRGHF 524          

HSP 2 Score: 21.9422 bits (45), Expect = 3.506e-61
Identity = 10/15 (66.67%), Postives = 11/15 (73.33%), Query Frame = 2
Query:  824 FFDKSDVFSFGVCCL 868
            F  KSDV+SFGV  L
Sbjct:  524 FSMKSDVYSFGVLVL 538          
BLAST of EY728231 vs. ExPASy Swiss-Prot
Match: CRK5_ARATH (Cysteine-rich receptor-like protein kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=1 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 3.507e-61
Identity = 116/196 (59.18%), Postives = 146/196 (74.49%), Query Frame = 1
Query:  244 FSFSSVSSATGNFSAANKLGEGGFGTVYKGVIGQG-EIAVKRLLGKSGQEIKELKNEASVIAQVQHKNLVKLLGCCIEKDERLLIYEYMPNKSLDCFLFDPTKREILDWRTRVQIIKGVAQGLLYLHQYSRVRIIHRDLKASNILLDKDMNPKISDFGMARIVFGGNDXDELXXHTSXISGTYGYMSPEYALEGIF 828
            F F  + +AT  FS  NKLG+GGFG VYKG +  G ++AVKRL   SGQ  KE KNE  V+A++QH+NLVKLLG C+E++E++L+YE++ NKSLD FLFD   +  LDW TR +II G+A+G+LYLHQ SR+ IIHRDLKA NILLD DMNPK++DFGMARI     + D+   HT  + GTYGYMSPEYA+ G F
Sbjct:  328 FDFKVIEAATDKFSMCNKLGQGGFGQVYKGTLPNGVQVAVKRLSKTSGQGEKEFKNEVVVVAKLQHRNLVKLLGFCLEREEKILVYEFVSNKSLDYFLFDSRMQSQLDWTTRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDADMNPKVADFGMARIF----EIDQTEAHTRRVVGTYGYMSPEYAMYGQF 519          

HSP 2 Score: 22.7126 bits (47), Expect = 3.507e-61
Identity = 10/16 (62.50%), Postives = 12/16 (75.00%), Query Frame = 2
Query:  821 EFFDKSDVFSFGVCCL 868
            +F  KSDV+SFGV  L
Sbjct:  518 QFSMKSDVYSFGVLVL 533          
BLAST of EY728231 vs. ExPASy Swiss-Prot
Match: CRK25_ARATH (Cysteine-rich receptor-like protein kinase 25 OS=Arabidopsis thaliana GN=CRK25 PE=2 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 7.942e-61
Identity = 117/194 (60.31%), Postives = 150/194 (77.32%), Query Frame = 1
Query:  244 FSFSSVSSATGNFSAANKLGEGGFGTVYKGVIGQGE-IAVKRLLGKSGQEIKELKNEASVIAQVQHKNLVKLLGCCIEKDERLLIYEYMPNKSLDCFLFDPTKREILDWRTRVQIIKGVAQGLLYLHQYSRVRIIHRDLKASNILLDKDMNPKISDFGMARIVFGGNDXDELXXHTSXISGTYGYMSPEYALEG 822
            F FS++ +AT  FS +NKLG GGFG VYKG +  GE +A+KRL   S Q  +E KNE  V+A++QH+NL KLLG C++ +E++L+YE++PNKSLD FLFD  KR +LDW+ R +II+G+A+G+LYLH+ SR+ IIHRDLKASNILLD DM+PKISDFGMARI FG    D+   +T  I GTYGYMSPEYA+ G
Sbjct:  335 FQFSAIEAATNKFSESNKLGHGGFGEVYKGQLITGETVAIKRLSQGSTQGAEEFKNEVDVVAKLQHRNLAKLLGYCLDGEEKILVYEFVPNKSLDYFLFDNEKRRVLDWQRRYKIIEGIARGILYLHRDSRLTIIHRDLKASNILLDADMHPKISDFGMARI-FG---VDQTQANTKRIVGTYGYMSPEYAIHG 524          
BLAST of EY728231 vs. ExPASy Swiss-Prot
Match: CRK10_ARATH (Cysteine-rich receptor-like protein kinase 10 OS=Arabidopsis thaliana GN=CRK10 PE=1 SV=2)

HSP 1 Score: 234.187 bits (596), Expect = 7.942e-61
Identity = 118/192 (61.46%), Postives = 149/192 (77.60%), Query Frame = 1
Query:  250 FSSVSSATGNFSAANKLGEGGFGTVYKGVIGQG-EIAVKRLLGKSGQEIKELKNEASVIAQVQHKNLVKLLGCCIEKDERLLIYEYMPNKSLDCFLFDPTKREILDWRTRVQIIKGVAQGLLYLHQYSRVRIIHRDLKASNILLDKDMNPKISDFGMARIVFGGNDXDELXXHTSXISGTYGYMSPEYALEG 822
            + ++ +AT +F  +NK+G+GGFG VYKG +  G E+AVKRL   SGQ   E KNE  ++A++QH+NLV+LLG C++ +ER+L+YEY+PNKSLD FLFDP K+  LDW  R +II GVA+G+LYLHQ SR+ IIHRDLKASNILLD DMNPKI+DFGMARI FG    D+   +TS I GTYGYMSPEYA+ G
Sbjct:  327 YRTIQTATDDFVESNKIGQGGFGEVYKGTLSDGTEVAVKRLSKSSGQGEVEFKNEVVLVAKLQHRNLVRLLGFCLDGEERVLVYEYVPNKSLDYFLFDPAKKGQLDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGMARI-FG---LDQTEENTSRIVGTYGYMSPEYAMHG 514          
BLAST of EY728231 vs. ExPASy Swiss-Prot
Match: CRK11_ARATH (Cysteine-rich receptor-like protein kinase 11 OS=Arabidopsis thaliana GN=CRK11 PE=2 SV=2)

HSP 1 Score: 233.802 bits (595), Expect = 1.037e-60
Identity = 114/195 (58.46%), Postives = 153/195 (78.46%), Query Frame = 1
Query:  241 LFSFSSVSSATGNFSAANKLGEGGFGTVYKGVIGQG-EIAVKRLLGKSGQEIKELKNEASVIAQVQHKNLVKLLGCCIEKDERLLIYEYMPNKSLDCFLFDPTKREILDWRTRVQIIKGVAQGLLYLHQYSRVRIIHRDLKASNILLDKDMNPKISDFGMARIVFGGNDXDELXXHTSXISGTYGYMSPEYALEG 822
            ++ F ++ +AT  FS +NKLGEGGFG VYKG +  G ++AVKRL  KSGQ  +E +NEA ++ ++QH+NLV+LLG C+E++E++LIYE++ NKSLD FLFDP K+  LDW  R +II G+A+G+LYLHQ SR++IIHRDLKASNILLD DMNPKI+DFG+A I FG    ++   +T+ I+GTY YMSPEYA+ G
Sbjct:  337 VYDFKTIEAATNKFSTSNKLGEGGFGAVYKGKLSNGTDVAVKRLSKKSGQGTREFRNEAVLVTKLQHRNLVRLLGFCLEREEQILIYEFVHNKSLDYFLFDPEKQSQLDWTRRYKIIGGIARGILYLHQDSRLKIIHRDLKASNILLDADMNPKIADFGLATI-FG---VEQTQGNTNRIAGTYAYMSPEYAMHG 527          
BLAST of EY728231 vs. ExPASy Swiss-Prot
Match: CRK37_ARATH (Cysteine-rich receptor-like protein kinase 37 OS=Arabidopsis thaliana GN=CRK37 PE=2 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 1.322e-60
Identity = 117/196 (59.69%), Postives = 145/196 (73.98%), Query Frame = 1
Query:  244 FSFSSVSSATGNFSAANKLGEGGFGTVYKGVIGQG-EIAVKRLLGKSGQEIKELKNEASVIAQVQHKNLVKLLGCCIEKDERLLIYEYMPNKSLDCFLFDPTKREILDWRTRVQIIKGVAQGLLYLHQYSRVRIIHRDLKASNILLDKDMNPKISDFGMARIVFGGNDXDELXXHTSXISGTYGYMSPEYALEGIF 828
            F    + +AT NFS  NKLG+GGFG+VYKG++  G EIAVKRL   SGQ   E KNE  ++ ++QH+NLVKLLG C EKDE +L+YE++PN SLD F+FD  KR +L W  R  II+GVA+GLLYLH+ S++RIIHRDLKASNILLD +MNPK++DFGMAR+     D DE    TS + GTYGYM+PEYA  G F
Sbjct:  333 FDLRMIVTATNNFSLENKLGQGGFGSVYKGILPSGQEIAVKRLRKGSGQGGMEFKNEVLLLTRLQHRNLVKLLGFCNEKDEEILVYEFVPNSSLDHFIFDEEKRRVLTWDVRYTIIEGVARGLLYLHEDSQLRIIHRDLKASNILLDAEMNPKVADFGMARLF----DMDETRGQTSRVVGTYGYMAPEYATYGQF 524          

HSP 2 Score: 23.483 bits (49), Expect = 1.322e-60
Identity = 10/16 (62.50%), Postives = 12/16 (75.00%), Query Frame = 2
Query:  821 EFFDKSDVFSFGVCCL 868
            +F  KSDV+SFGV  L
Sbjct:  523 QFSTKSDVYSFGVMLL 538          
BLAST of EY728231 vs. ExPASy Swiss-Prot
Match: CRK29_ARATH (Cysteine-rich receptor-like protein kinase 29 OS=Arabidopsis thaliana GN=CRK29 PE=2 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 2.246e-60
Identity = 116/197 (58.88%), Postives = 151/197 (76.65%), Query Frame = 1
Query:  241 LFSFSSVSSATGNFSAANKLGEGGFGTVYKGVIGQG-EIAVKRLLGKSGQEIKELKNEASVIAQVQHKNLVKLLGCCIEKDERLLIYEYMPNKSLDCFLFDPTKREILDWRTRVQIIKGVAQGLLYLHQYSRVRIIHRDLKASNILLDKDMNPKISDFGMARIVFGGNDXDELXXHTSXISGTYGYMSPEYALEGIF 828
            L  F ++ +AT NFS+ N+LG GGFG+VYKGV  QG EIAVKRL G SGQ   E KNE  ++A++QH+NLV+L+G CI+ +ERLL+YE++ N SLD F+FD  KR++LDW  R ++I G+A+GLLYLH+ SR RIIHRDLKASNILLD++MNPKI+DFG+A++   G         TS I+GTYGYM+PEYA+ G F
Sbjct:  344 LVHFETLKTATDNFSSENELGRGGFGSVYKGVFPQGQEIAVKRLSGNSGQGDNEFKNEILLLAKLQHRNLVRLIGFCIQGEERLLVYEFIKNASLDQFIFDTEKRQLLDWVVRYKMIGGIARGLLYLHEDSRFRIIHRDLKASNILLDQEMNPKIADFGLAKLFDSGQTMTH--RFTSRIAGTYGYMAPEYAMHGQF 538          

HSP 2 Score: 21.9422 bits (45), Expect = 2.246e-60
Identity = 9/13 (69.23%), Postives = 11/13 (84.62%), Query Frame = 2
Query:  821 EFFDKSDVFSFGV 859
            +F  K+DVFSFGV
Sbjct:  537 QFSVKTDVFSFGV 549          
BLAST of EY728231 vs. ExPASy Swiss-Prot
Match: SRK6_BRAOE (Putative serine/threonine-protein kinase receptor OS=Brassica oleracea var. acephala GN=SRK6 PE=2 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 2.923e-60
Identity = 121/200 (60.50%), Postives = 144/200 (72.00%), Query Frame = 1
Query:  232 QFPLFSFSSVSSATGNFSAANKLGEGGFGTVYKGVIGQG-EIAVKRLLGKSGQEIKELKNEASVIAQVQHKNLVKLLGCCIEKDERLLIYEYMPNKSLDCFLFDPTKREILDWRTRVQIIKGVAQGLLYLHQYSRVRIIHRDLKASNILLDKDMNPKISDFGMARIVFGGNDXDELXXHTSXISGTYGYMSPEYALEGIF 828
            + PL    +V  AT NFS+ NKLG+GGFG VYKG +  G EIAVKRL   S Q   E  NE ++IA++QH NLV++LGCCIE DE++LIYEY+ N SLD +LF  T+R  L+W  R  I  GVA+GLLYLHQ SR RIIHRDLK SNILLDK+M PKISDFGMARI     + DE   +T  + GTYGYMSPEYA+ GIF
Sbjct:  512 ELPLIEMETVVKATENFSSCNKLGQGGFGIVYKGRLLDGKEIAVKRLSKTSVQGTDEFMNEVTLIARLQHINLVQVLGCCIEGDEKMLIYEYLENLSLDSYLFGKTRRSKLNWNERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIF----ERDETEANTMKVVGTYGYMSPEYAMYGIF 707          

HSP 2 Score: 25.0238 bits (53), Expect = 2.923e-60
Identity = 11/15 (73.33%), Postives = 12/15 (80.00%), Query Frame = 2
Query:  824 FFDKSDVFSFGVCCL 868
            F +KSDVFSFGV  L
Sbjct:  707 FSEKSDVFSFGVIVL 721          
BLAST of EY728231 vs. ExPASy Swiss-Prot
Match: CRK17_ARATH (Cysteine-rich receptor-like protein kinase 17 OS=Arabidopsis thaliana GN=CRK17 PE=2 SV=2)

HSP 1 Score: 231.491 bits (589), Expect = 2.928e-60
Identity = 123/219 (56.16%), Postives = 155/219 (70.78%), Query Frame = 1
Query:  202 CKKGCEKEVDQFPL---------FSFSSVSSATGNFSAANKLGEGGFGTVYKGVIGQG-EIAVKRLLGKSGQEIKELKNEASVIAQVQHKNLVKLLGCCIEKDERLLIYEYMPNKSLDCFLFDPTKREILDWRTRVQIIKGVAQGLLYLHQYSRVRIIHRDLKASNILLDKDMNPKISDFGMARIVFGGNDXDELXXHTSXISGTYGYMSPEYALEGIF 828
            CK+  +K+  + P+         F   ++ +ATGNFS  NKLG GGFG VYKG++  G EIAVKRL   SGQ   E KNE  V+A++QH NLV+LLG  ++ +E+LL+YE++PNKSLD FLFDP KR  LDW  R  II G+ +G+LYLHQ SR++IIHRDLKASNILLD DMNPKI+DFGMARI FG    D+   +T+ + GT+GYMSPEY   G F
Sbjct:  324 CKRRKQKQEIELPIVLNEAESVQFDLKTIEAATGNFSEHNKLGAGGFGEVYKGMLLNGTEIAVKRLSKTSGQGEIEFKNEVVVVAKLQHINLVRLLGFSLQGEEKLLVYEFVPNKSLDYFLFDPNKRNQLDWTVRRNIIGGITRGILYLHQDSRLKIIHRDLKASNILLDADMNPKIADFGMARI-FG---VDQTVANTARVVGTFGYMSPEYVTHGQF 538          

HSP 2 Score: 22.7126 bits (47), Expect = 2.928e-60
Identity = 10/16 (62.50%), Postives = 12/16 (75.00%), Query Frame = 2
Query:  821 EFFDKSDVFSFGVCCL 868
            +F  KSDV+SFGV  L
Sbjct:  537 QFSMKSDVYSFGVLIL 552          
BLAST of EY728231 vs. ExPASy Swiss-Prot
Match: CRK31_ARATH (Putative cysteine-rich receptor-like protein kinase 31 OS=Arabidopsis thaliana GN=CRK31 PE=2 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 6.491e-60
Identity = 115/196 (58.67%), Postives = 143/196 (72.96%), Query Frame = 1
Query:  244 FSFSSVSSATGNFSAANKLGEGGFGTVYKGVI-GQGEIAVKRLLGKSGQEIKELKNEASVIAQVQHKNLVKLLGCCIEKDERLLIYEYMPNKSLDCFLFDPTKREILDWRTRVQIIKGVAQGLLYLHQYSRVRIIHRDLKASNILLDKDMNPKISDFGMARIVFGGNDXDELXXHTSXISGTYGYMSPEYALEGIF 828
            F F+++  AT NFS  NKLG+GGFG VYKG++  + EIAVKRL   SGQ  +E KNE  ++A++QHKNLV+LLG CIE+DE++L+YE++ NKSLD FLFDP  +  LDW+ R  II GV +GLLYLHQ SR+ IIHRD+KASNILLD DMNPKI+DFGMAR        D+    T  + GT+GYM PEY   G F
Sbjct:  327 FDFTTIEVATDNFSRNNKLGQGGFGEVYKGMLPNETEIAVKRLSSNSGQGTQEFKNEVVIVAKLQHKNLVRLLGFCIERDEQILVYEFVSNKSLDYFLFDPKMKSQLDWKRRYNIIGGVTRGLLYLHQDSRLTIIHRDIKASNILLDADMNPKIADFGMAR----NFRVDQTEDQTGRVVGTFGYMPPEYVTHGQF 518          

HSP 2 Score: 23.483 bits (49), Expect = 6.491e-60
Identity = 10/16 (62.50%), Postives = 12/16 (75.00%), Query Frame = 2
Query:  821 EFFDKSDVFSFGVCCL 868
            +F  KSDV+SFGV  L
Sbjct:  517 QFSTKSDVYSFGVLIL 532          
The following BLAST results are available for this feature:
BLAST of EY728231 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CRK35_ARATH3.506e-6160.20Putative cysteine-rich receptor-like protein kinas... [more]
CRK5_ARATH3.507e-6159.18Cysteine-rich receptor-like protein kinase 5 OS=Ar... [more]
CRK25_ARATH7.942e-6160.31Cysteine-rich receptor-like protein kinase 25 OS=A... [more]
CRK10_ARATH7.942e-6161.46Cysteine-rich receptor-like protein kinase 10 OS=A... [more]
CRK11_ARATH1.037e-6058.46Cysteine-rich receptor-like protein kinase 11 OS=A... [more]
CRK37_ARATH1.322e-6059.69Cysteine-rich receptor-like protein kinase 37 OS=A... [more]
CRK29_ARATH2.246e-6058.88Cysteine-rich receptor-like protein kinase 29 OS=A... [more]
SRK6_BRAOE2.923e-6060.50Putative serine/threonine-protein kinase receptor ... [more]
CRK17_ARATH2.928e-6056.16Cysteine-rich receptor-like protein kinase 17 OS=A... [more]
CRK31_ARATH6.491e-6058.67Putative cysteine-rich receptor-like protein kinas... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (5 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-704-001-B09-CT.F Sweet orange fruit, development stadium (5 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY728231 ID=EY728231|Name=EY728231|organism=Citrus sinensis|type=EST|length=905bp
CCACGCGTCCGATCGTTCACCGTAACCACAAATCGAACTATTTTTCTCGC
CCTATCGGCTACTCTAGCTGGAATGGCCGCCTTGGGCTTGACAATTTTTT
GTTTCAGGAGAAATACCACAAACAAAGGGGAGGATTTGATGAAATTTGAT
CTGGGTATGAACCTAAAGGTCGATGTAGAGCTTACAGAAGGCAATAATAA
GTGCAAAAAAGGGTGCGAAAAGGAAGTTGATCAATTTCCCTTGTTCAGTT
TTTCCAGTGTTTCTTCTGCAACTGGTAATTTCTCCGCAGCAAATAAGCTT
GGCGAAGGAGGCTTCGGAACTGTTTACAAGGGAGTAATAGGGCAAGGTGA
GATAGCTGTGAAAAGGCTTTTAGGAAAATCCGGACAGGAGATAAAAGAGT
TAAAAAACGAAGCATCGGTAATAGCCCAGGTTCAACACAAGAATCTTGTT
AAACTTTTGGGTTGCTGCATTGAGAAAGATGAGAGGTTATTGATCTATGA
GTACATGCCAAATAAAAGCTTGGATTGCTTCCTCTTTGATCCAACCAAAC
GAGAAATATTAGATTGGAGAACCCGTGTTCAGATCATTAAAGGAGTAGCT
CAAGGGCTTCTTTATCTTCATCAATATTCCAGAGTCCGAATCATTCACAG
GGATTTGAAAGCTAGCAATATCTTGTTGGATAAAGATATGAATCCTAAAA
TTTCAGATTTTGGAATGGCAAGAATAGTTTTTGGAGGGAATGATGANGAT
GAGTTACNANNGCACACTAGTANGATCTCCGGGACTTATGGATACATGTC
TCCTGAATATGCACTTGAAGGAATTTTTCGATAAATCGGATGTCTTTAGC
TTCGGAGTTTGTTGCTTGAGACGTGAGTGGCAGAAGACACTGGATTTATC
GAACA
back to top