EY753853
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of EY753853 vs. ExPASy Swiss-Prot
Match: ZN363_HUMAN (RING finger and CHY zinc finger domain-containing protein 1 OS=Homo sapiens GN=RCHY1 PE=1 SV=1) HSP 1 Score: 92.0485 bits (227), Expect = 4.207e-18 Identity = 42/89 (47.19%), Postives = 52/89 (58.43%), Query Frame = 2 Query: 2 HASDKNCLKEMREHHQYACPICSKSVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGKTSNVQFHVLAQKCPNCKSYNTRLTRG 268 H + C +EM + Y CP+C S DM++ W + D E+A TPMP Y N V ILCNDC S VQFH+L KC C+SYNT G Sbjct: 166 HLLHRTCYEEMLKEG-YRCPLCMHSALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKCKICESYNTAQAGG 253
BLAST of EY753853 vs. ExPASy Swiss-Prot
Match: ZN363_MOUSE (RING finger and CHY zinc finger domain-containing protein 1 OS=Mus musculus GN=Rchy1 PE=1 SV=1) HSP 1 Score: 91.2781 bits (225), Expect = 7.177e-18 Identity = 42/89 (47.19%), Postives = 51/89 (57.30%), Query Frame = 2 Query: 2 HASDKNCLKEMREHHQYACPICSKSVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGKTSNVQFHVLAQKCPNCKSYNTRLTRG 268 H + C +EM + Y CP+C S DM++ W + D E+A TPMP Y N V ILCNDC S VQFH+L KC C SYNT G Sbjct: 166 HLLHRTCYEEMLKEG-YRCPLCMHSALDMTRYWRQLDTEVAQTPMPSEYQNVTVDILCNDCNGRSTVQFHILGMKCKLCDSYNTAQAGG 253 The following BLAST results are available for this feature:
BLAST of EY753853 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY753853 ID=EY753853; Name=EY753853; organism=Citrus sinensis; type=EST; length=825bpback to top |