FK826740

Overview
NameFK826740
Unique NameFK826740
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length275
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2579 contig Csv1_Contig2579:538..812. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FK826740 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 6.120e-13
Identity = 31/49 (63.27%), Postives = 38/49 (77.55%), Query Frame = -2
Query:  122 KKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 268
            KKGSSY AD +ET+ S ++  VVMD  AAE +G CKCGP+C+C NCTCG
Sbjct:   18 KKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64          
The following BLAST results are available for this feature:
BLAST of FK826740 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
MT3_CARPA6.120e-1363.27Metallothionein-like protein type 3 OS=Carica papa... [more]
back to top
Properties
Property NameValue
Genbank descriptionclone558 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 558, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826740 ID=FK826740|Name=FK826740|organism=Citrus sinensis|type=EST|length=275bp
ACTTTTTTTTTTTTTTTTTTTTTTTTTTTTAGTCACCCTTACATTATTCT
TAACCCCCACAATATTTAGGCACACTTGCAGCTTCTTATTTTTTGCTGCA
TGTGTTTGCTTATTAGTGACTACCACAAGTGCAGTTCACACAAGCGCAGG
TGGGGCCGCACTTGCAGTTACCTTCAGTCTCAGCAGCCTGAACGTCCATG
ACAACAACGGTGCTGACAAAGCTCAAGTCAGTCTCGACGAAGTCAGCAGC
ATAGCTGCTTCCCTTCTTCCCCGCG
back to top