FK826727

Overview
NameFK826727
Unique NameFK826727
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length352
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12935 contig Csv1_Contig12935:394..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FK826727 vs. ExPASy Swiss-Prot
Match: POT11_ARATH (Potassium transporter 11 OS=Arabidopsis thaliana GN=POT11 PE=1 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 8.321e-34
Identity = 73/111 (65.77%), Postives = 83/111 (74.77%), Query Frame = -2
Query:   22 LPVYTVPEEERFLVKRIGPKNFHMFRCVARYGYKDLHKKDENFEKELFDSLFLFVRLEAMME-GCSDSDEYSLYGQQTLQXXXXXXXXXXXXXXXNQDLTMSSVDSIVPVK 351
            LPVYTVPEEERFLVKRIGPKNFHMFRCVARYGY+DLHKKD++FEK LF+SLFL+VRLE+MME GCSDSD+YS+ G Q  Q                   T  S++SI PVK
Sbjct:  598 LPVYTVPEEERFLVKRIGPKNFHMFRCVARYGYRDLHKKDDDFEKRLFESLFLYVRLESMMEGGCSDSDDYSICGSQ--QQLKDTLGNGNENENLATFDTFDSIESITPVK 706          
BLAST of FK826727 vs. ExPASy Swiss-Prot
Match: POT10_ARATH (Putative potassium transporter 10 OS=Arabidopsis thaliana GN=POT10 PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 8.321e-34
Identity = 64/79 (81.01%), Postives = 74/79 (93.67%), Query Frame = -2
Query:  115 LPVYTVPEEERFLVKRIGPKNFHMFRCVARYGYKDLHKKDENFEKELFDSLFLFVRLEAMMEGCSDSDEYSLYGQQTLQ 351
            LPVYTVP+EERFLVKRIGPKNFHMFRCVARYGY+DLHKKD++FEK LF+SLFLF+RLE+MMEGCSDS++YS+ G Q  Q
Sbjct:  588 LPVYTVPQEERFLVKRIGPKNFHMFRCVARYGYRDLHKKDDDFEKRLFESLFLFLRLESMMEGCSDSEDYSVCGSQQRQ 666          
BLAST of FK826727 vs. ExPASy Swiss-Prot
Match: HAK11_ORYSJ (Probable potassium transporter 11 OS=Oryza sativa subsp. japonica GN=HAK11 PE=2 SV=3)

HSP 1 Score: 139.813 bits (351), Expect = 4.130e-33
Identity = 73/120 (60.83%), Postives = 88/120 (73.33%), Query Frame = -2
Query:    1 LPVYTVPEEERFLVKRIGPKNFHMFRCVARYGYKDLHKKDENFEKELFDSLFLFVRLEAMMEGCSDSDEYSLYGQQT---LQXXXXXXXXXXXXXXXNQDLTMSSVDSIVPVKSPLHVNS 351
            LPVYTVP +ERFLV+RIGPKNFH+FRCVARYGYKDLHKKDE+FEK LF+ L  F+RLE+MMEG SDSD++S+  Q+T   +                + DL+ SS DSIVPV+SPL  NS
Sbjct:  588 LPVYTVPMDERFLVRRIGPKNFHIFRCVARYGYKDLHKKDEDFEKMLFNCLLSFLRLESMMEGYSDSDDFSVPEQRTEGSISNAFLAEKTNNNTMCSHGDLSYSSQDSIVPVQSPLRGNS 707          
BLAST of FK826727 vs. ExPASy Swiss-Prot
Match: HAK12_ORYSJ (Putative potassium transporter 12 OS=Oryza sativa subsp. japonica GN=HAK12 PE=2 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.735e-31
Identity = 68/120 (56.67%), Postives = 84/120 (70.00%), Query Frame = -2
Query:    1 LPVYTVPEEERFLVKRIGPKNFHMFRCVARYGYKDLHKKDENFEKELFDSLFLFVRLEAMMEGCSDSDEYSLYGQQT---LQXXXXXXXXXXXXXXXNQDLTMSSVDSIVPVKSPLHVNS 351
            LPVYTVP EERF+VKRIGPKNFHMFRCVARYGYKD+HK+D++FEK L D L LFVRLE+MM+  SDS+++++  ++T                      DL+ SS DSIVP KSP+  NS
Sbjct:  588 LPVYTVPTEERFIVKRIGPKNFHMFRCVARYGYKDIHKRDDDFEKMLLDRLLLFVRLESMMDDYSDSEDFTMMEEKTQGSSNALLLTGKAGSNTMCSTGDLSYSSQDSIVPAKSPIRGNS 707          
BLAST of FK826727 vs. ExPASy Swiss-Prot
Match: HAK18_ORYSJ (Potassium transporter 18 OS=Oryza sativa subsp. japonica GN=HAK18 PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 2.505e-30
Identity = 61/71 (85.92%), Postives = 66/71 (92.96%), Query Frame = -2
Query:  139 LPVYTVPEEERFLVKRIGPKNFHMFRCVARYGYKDLHKKDENFEKELFDSLFLFVRLEAMMEGCSDSDEYS 351
            LPVYTVP +ERFLVKRIGPKNFHMFRCVARYGYKD+HKKD++FEK LFDSL LFVRLE+MME  SDSDEYS
Sbjct:  586 LPVYTVPPDERFLVKRIGPKNFHMFRCVARYGYKDIHKKDDDFEKMLFDSLILFVRLESMMEEYSDSDEYS 656          
BLAST of FK826727 vs. ExPASy Swiss-Prot
Match: POT9_ARATH (Potassium transporter 9 OS=Arabidopsis thaliana GN=POT9 PE=2 SV=2)

HSP 1 Score: 111.309 bits (277), Expect = 1.573e-24
Identity = 52/71 (73.24%), Postives = 58/71 (81.69%), Query Frame = -2
Query:  139 LPVYTVPEEERFLVKRIGPKNFHMFRCVARYGYKDLHKKDENFEKELFDSLFLFVRLEAMMEGCSDSDEYS 351
            LPVYTVPEEERFLVKRIGPK F MFRCVARYGYKDLHKKD++FE +L   L  F+R+E MME  S+S  YS
Sbjct:  598 LPVYTVPEEERFLVKRIGPKTFRMFRCVARYGYKDLHKKDDDFENKLLTKLSSFIRIETMMEPTSNSSTYS 668          
BLAST of FK826727 vs. ExPASy Swiss-Prot
Match: HAK7_ORYSJ (Potassium transporter 7 OS=Oryza sativa subsp. japonica GN=HAK7 PE=2 SV=3)

HSP 1 Score: 78.5666 bits (192), Expect = 1.130e-14
Identity = 36/71 (50.70%), Postives = 49/71 (69.01%), Query Frame = -2
Query:  139 LPVYTVPEEERFLVKRIGPKNFHMFRCVARYGYKDLHKKDENFEKELFDSLFLFVRLEAMMEGCSDSDEYS 351
            +PV  VPE+ER+L+ RIGP+ + M+RC+ RYGYKD+ K DENFE  L  S+  F+++EA     S S E S
Sbjct:  595 VPVPFVPEDERYLIGRIGPREYRMYRCIVRYGYKDVQKDDENFENHLVMSIAKFIQMEAEEAASSGSYESS 665          
BLAST of FK826727 vs. ExPASy Swiss-Prot
Match: POT12_ARATH (Putative potassium transporter 12 OS=Arabidopsis thaliana GN=POT12 PE=1 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 5.607e-14
Identity = 35/61 (57.38%), Postives = 48/61 (78.69%), Query Frame = -2
Query:  172 LPVYTVPEEERFLVKRIGPKNFHMFRCVARYGYKDLHKKDEN-FEKELFDSLFLFVRLEAM 351
            +PV  VP+EERFL +R+ PK++HMFRC+ARYGYKD+ K+D   FE+ L +SL  F+R EA+
Sbjct:  631 VPVPVVPQEERFLFRRVCPKDYHMFRCIARYGYKDVRKEDSRVFEQLLIESLEKFLRCEAL 691          
BLAST of FK826727 vs. ExPASy Swiss-Prot
Match: HAK14_ORYSJ (Probable potassium transporter 14 OS=Oryza sativa subsp. japonica GN=HAK14 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 9.565e-14
Identity = 37/71 (52.11%), Postives = 53/71 (74.65%), Query Frame = -2
Query:  142 LPVYTVPEEERFLVKRIGPKNFHMFRCVARYGYKDLHKKDE-NFEKELFDSLFLFVRLEAMMEGCSDSDEY 351
            +PV  VP+ ERFL +R+ PK++HMFRC+ARYGYKD+ K+D  +F++ L +SL  F+R EA  E   +SD+Y
Sbjct:  655 VPVPVVPQNERFLFRRVCPKSYHMFRCIARYGYKDIRKEDYISFQQLLIESLEKFMRREA-QERSLESDQY 724          
BLAST of FK826727 vs. ExPASy Swiss-Prot
Match: POT8_ARATH (Potassium transporter 8 OS=Arabidopsis thaliana GN=POT8 PE=2 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 1.804e-12
Identity = 32/71 (45.07%), Postives = 46/71 (64.79%), Query Frame = -2
Query:  139 LPVYTVPEEERFLVKRIGPKNFHMFRCVARYGYKDLHKKDENFEKELFDSLFLFVRLEAMMEGCSDSDEYS 351
            +PV  V  EERFLV R+GPK + ++RC+ARYGY+D+HK D  FE +L  S+  F+R +  +    D +  S
Sbjct:  574 VPVPHVKPEERFLVGRVGPKEYRLYRCIARYGYRDVHKDDVEFENDLICSIAEFIRSDKPLNYSPDPENES 644          
The following BLAST results are available for this feature:
BLAST of FK826727 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 20
Match NameE-valueIdentityDescription
POT11_ARATH8.321e-3465.77Potassium transporter 11 OS=Arabidopsis thaliana G... [more]
POT10_ARATH8.321e-3481.01Putative potassium transporter 10 OS=Arabidopsis t... [more]
HAK11_ORYSJ4.130e-3360.83Probable potassium transporter 11 OS=Oryza sativa ... [more]
HAK12_ORYSJ1.735e-3156.67Putative potassium transporter 12 OS=Oryza sativa ... [more]
HAK18_ORYSJ2.505e-3085.92Potassium transporter 18 OS=Oryza sativa subsp. ja... [more]
POT9_ARATH1.573e-2473.24Potassium transporter 9 OS=Arabidopsis thaliana GN... [more]
HAK7_ORYSJ1.130e-1450.70Potassium transporter 7 OS=Oryza sativa subsp. jap... [more]
POT12_ARATH5.607e-1457.38Putative potassium transporter 12 OS=Arabidopsis t... [more]
HAK14_ORYSJ9.565e-1452.11Probable potassium transporter 14 OS=Oryza sativa ... [more]
POT8_ARATH1.804e-1245.07Potassium transporter 8 OS=Arabidopsis thaliana GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionclone502 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 502, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826727 ID=FK826727|Name=FK826727|organism=Citrus sinensis|type=EST|length=352bp
ACTATTTACATGCAACGGCGATTTCACAGGCACAATCGAGTCGACGGATG
ACATTGTTAGGTCTTGATTTGAGGAAGTTGAGTTTCCATTATTATTTAGC
AGGCCATCCGTTGACTGTAGAGTTTGCTGGCCATACAAACTATATTCATC
TGAATCAGAACAACCCTCCATCATGGCTTCAAGCCGGACAAACAAGAAGA
GACTATCAAACAGCTCTTTCTCAAAATTCTCATCTTTCTTATGGAGGTCC
TTATAGCCATACCTTGCTACGCAACGGAACATATGGAAATTCTTGGGTCC
TATCCGCTTTACAAGGAACCTTTCTTCTTCGGGGACTGTGTAAACAGGTA
GG
back to top