FK826725

Overview
NameFK826725
Unique NameFK826725
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length346
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12391 contig Csv1_Contig12391:574..919. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FK826725 vs. ExPASy Swiss-Prot
Match: TBA3_ARATH (Tubulin alpha-3/alpha-5 chain OS=Arabidopsis thaliana GN=TUBA3 PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 1.628e-42
Identity = 87/101 (86.14%), Postives = 87/101 (86.14%), Query Frame = 1
Query:   43 VDYGKKSKLGFTIYPSPQVSTAVVETYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRXXXXXXXXXXXXXRFDGAINVDITEFQTNL 345
            VDYGKKSKLGFTIYPSPQVSTAVVE YNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNR             RFDGAINVDITEFQTNL
Sbjct:  159 VDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNL 259          
BLAST of FK826725 vs. ExPASy Swiss-Prot
Match: TBA_AVESA (Tubulin alpha chain OS=Avena sativa GN=TUBA PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 2.126e-42
Identity = 86/101 (85.15%), Postives = 87/101 (86.14%), Query Frame = 1
Query:   43 VDYGKKSKLGFTIYPSPQVSTAVVETYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRXXXXXXXXXXXXXRFDGAINVDITEFQTNL 345
            VDYGKKSKLGFTIYPSPQVSTAVVE YNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNR             RFDGAINVD+TEFQTNL
Sbjct:  159 VDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNL 259          
BLAST of FK826725 vs. ExPASy Swiss-Prot
Match: TBA6_MAIZE (Tubulin alpha-6 chain OS=Zea mays GN=TUBA6 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 2.126e-42
Identity = 86/101 (85.15%), Postives = 87/101 (86.14%), Query Frame = 1
Query:   43 VDYGKKSKLGFTIYPSPQVSTAVVETYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRXXXXXXXXXXXXXRFDGAINVDITEFQTNL 345
            VDYGKKSKLGFTIYPSPQVSTAVVE YNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNR             RFDGAINVD+TEFQTNL
Sbjct:  159 VDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNL 259          
BLAST of FK826725 vs. ExPASy Swiss-Prot
Match: TBA5_MAIZE (Tubulin alpha-5 chain OS=Zea mays GN=TUBA5 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 2.126e-42
Identity = 86/101 (85.15%), Postives = 87/101 (86.14%), Query Frame = 1
Query:   43 VDYGKKSKLGFTIYPSPQVSTAVVETYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRXXXXXXXXXXXXXRFDGAINVDITEFQTNL 345
            VDYGKKSKLGFTIYPSPQVSTAVVE YNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNR             RFDGAINVD+TEFQTNL
Sbjct:  159 VDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNL 259          
BLAST of FK826725 vs. ExPASy Swiss-Prot
Match: TBA3_ELEIN (Tubulin alpha-3 chain OS=Eleusine indica GN=TUBA3 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 2.126e-42
Identity = 86/101 (85.15%), Postives = 87/101 (86.14%), Query Frame = 1
Query:   43 VDYGKKSKLGFTIYPSPQVSTAVVETYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRXXXXXXXXXXXXXRFDGAINVDITEFQTNL 345
            VDYGKKSKLGFTIYPSPQVSTAVVE YNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNR             RFDGAINVD+TEFQTNL
Sbjct:  159 VDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNL 259          
BLAST of FK826725 vs. ExPASy Swiss-Prot
Match: TBA1_ORYSJ (Tubulin alpha-1 chain OS=Oryza sativa subsp. japonica GN=TUBA1 PE=1 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 2.126e-42
Identity = 86/101 (85.15%), Postives = 87/101 (86.14%), Query Frame = 1
Query:   43 VDYGKKSKLGFTIYPSPQVSTAVVETYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRXXXXXXXXXXXXXRFDGAINVDITEFQTNL 345
            VDYGKKSKLGFTIYPSPQVSTAVVE YNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNR             RFDGAINVD+TEFQTNL
Sbjct:  159 VDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNL 259          
BLAST of FK826725 vs. ExPASy Swiss-Prot
Match: TBA1_HORVU (Tubulin alpha-1 chain OS=Hordeum vulgare GN=TUBA1 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 2.126e-42
Identity = 86/101 (85.15%), Postives = 87/101 (86.14%), Query Frame = 1
Query:   43 VDYGKKSKLGFTIYPSPQVSTAVVETYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRXXXXXXXXXXXXXRFDGAINVDITEFQTNL 345
            VDYGKKSKLGFTIYPSPQVSTAVVE YNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNR             RFDGAINVD+TEFQTNL
Sbjct:  159 VDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNL 259          
BLAST of FK826725 vs. ExPASy Swiss-Prot
Match: TBA2_CHLRE (Tubulin alpha-2 chain OS=Chlamydomonas reinhardtii GN=TUBA2 PE=1 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 6.187e-42
Identity = 84/101 (83.17%), Postives = 87/101 (86.14%), Query Frame = 1
Query:   43 VDYGKKSKLGFTIYPSPQVSTAVVETYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRXXXXXXXXXXXXXRFDGAINVDITEFQTNL 345
            VDYGKKSKLGFT+YPSPQVSTAVVE YNSVLSTHSLLEHTDVAV+LDNEAIYDICRRSLDIERPTYTNLNR             RFDGA+NVDITEFQTNL
Sbjct:  159 VDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVMLDNEAIYDICRRSLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDITEFQTNL 259          
BLAST of FK826725 vs. ExPASy Swiss-Prot
Match: TBA1_CHLRE (Tubulin alpha-1 chain OS=Chlamydomonas reinhardtii GN=TUBA1 PE=1 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 6.187e-42
Identity = 84/101 (83.17%), Postives = 87/101 (86.14%), Query Frame = 1
Query:   43 VDYGKKSKLGFTIYPSPQVSTAVVETYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRXXXXXXXXXXXXXRFDGAINVDITEFQTNL 345
            VDYGKKSKLGFT+YPSPQVSTAVVE YNSVLSTHSLLEHTDVAV+LDNEAIYDICRRSLDIERPTYTNLNR             RFDGA+NVDITEFQTNL
Sbjct:  159 VDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVMLDNEAIYDICRRSLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDITEFQTNL 259          
BLAST of FK826725 vs. ExPASy Swiss-Prot
Match: TBA1_VOLCA (Tubulin alpha-1/alpha-2 chain OS=Volvox carteri GN=TUBA1 PE=3 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 8.080e-42
Identity = 83/101 (82.18%), Postives = 87/101 (86.14%), Query Frame = 1
Query:   43 VDYGKKSKLGFTIYPSPQVSTAVVETYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRXXXXXXXXXXXXXRFDGAINVDITEFQTNL 345
            VDYGKKSKLGFT+YPSPQVSTAVVE YNSVLSTHSLLEHTDVAV+LDNEAIYDICRRSLDIERPTYTNLNR             RFDGA+NVD+TEFQTNL
Sbjct:  159 VDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVMLDNEAIYDICRRSLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDVTEFQTNL 259          
The following BLAST results are available for this feature:
BLAST of FK826725 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 371
Match NameE-valueIdentityDescription
TBA3_ARATH1.628e-4286.14Tubulin alpha-3/alpha-5 chain OS=Arabidopsis thali... [more]
TBA_AVESA2.126e-4285.15Tubulin alpha chain OS=Avena sativa GN=TUBA PE=2 S... [more]
TBA6_MAIZE2.126e-4285.15Tubulin alpha-6 chain OS=Zea mays GN=TUBA6 PE=2 SV... [more]
TBA5_MAIZE2.126e-4285.15Tubulin alpha-5 chain OS=Zea mays GN=TUBA5 PE=2 SV... [more]
TBA3_ELEIN2.126e-4285.15Tubulin alpha-3 chain OS=Eleusine indica GN=TUBA3 ... [more]
TBA1_ORYSJ2.126e-4285.15Tubulin alpha-1 chain OS=Oryza sativa subsp. japon... [more]
TBA1_HORVU2.126e-4285.15Tubulin alpha-1 chain OS=Hordeum vulgare GN=TUBA1 ... [more]
TBA2_CHLRE6.187e-4283.17Tubulin alpha-2 chain OS=Chlamydomonas reinhardtii... [more]
TBA1_CHLRE6.187e-4283.17Tubulin alpha-1 chain OS=Chlamydomonas reinhardtii... [more]
TBA1_VOLCA8.080e-4282.18Tubulin alpha-1/alpha-2 chain OS=Volvox carteri GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionclone499 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 499, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826725 ID=FK826725|Name=FK826725|organism=Citrus sinensis|type=EST|length=346bp
ACTGGTTCCGGTCTGGGGTCGTTGTTACTGGAACGCCTATCTGTAGATTA
TGGAAAGAAGTCAAAGCTTGGCTTCACTATCTACCCTTCTCCTCAGGTAT
CAACAGCAGTTGTGGAGACTTATAACAGTGTTCTGTCTACTCATTCCCTT
CTTGAACACACAGATGTTGCTGTGCTATTGGACAATGAAGCTATTTATGA
CATCTGCAGGAGATCCCTGGATATTGAGAGGCCAACTTACACTAATTTGA
ATCGATTGATATCTCAAATCATATCATCTTTGACAACTTCATTGAGGTTT
GATGGAGCTATTAATGTTGATATTACAGAGTTCCAGACCAACCTTG
back to top