FK826724

Overview
NameFK826724
Unique NameFK826724
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length162
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6119 contig Csv1_Contig6119:617..778. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FK826724 vs. ExPASy Swiss-Prot
Match: RBD2A_ARATH (Ras-related protein RABD2A OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3)

HSP 1 Score: 96.6709 bits (239), Expect = 3.990e-20
Identity = 48/53 (90.57%), Postives = 51/53 (96.23%), Query Frame = -2
Query:    3 ETAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKGRMASQPSMNNARPPT 161
            ETAKAFADEIGIPFMETSAKD+TNVEQAFMAM+ASIK RMASQP+ NNARPPT
Sbjct:  134 ETAKAFADEIGIPFMETSAKDATNVEQAFMAMSASIKERMASQPAGNNARPPT 186          
BLAST of FK826724 vs. ExPASy Swiss-Prot
Match: YPTM2_MAIZE (GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.087e-17
Identity = 44/53 (83.02%), Postives = 49/53 (92.45%), Query Frame = -2
Query:    3 ETAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKGRMASQPSMNNARPPT 161
            ETAKAFADE+GIPFMETSAK++TNV+QAFMAMAASIK RMASQP+  NARP T
Sbjct:  134 ETAKAFADEMGIPFMETSAKNATNVQQAFMAMAASIKDRMASQPAAANARPAT 186          
BLAST of FK826724 vs. ExPASy Swiss-Prot
Match: RIC1_ORYSJ (Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 1.918e-14
Identity = 37/53 (69.81%), Postives = 43/53 (81.13%), Query Frame = -2
Query:    3 ETAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKGRMASQPSMNNARPPT 161
            E  KA ADEIGIPF+ETSAKD+TNVE+AFM MA  IK RMASQP+ N ++P T
Sbjct:  134 EAGKALADEIGIPFLETSAKDATNVEKAFMTMAGEIKNRMASQPATNASKPAT 186          
BLAST of FK826724 vs. ExPASy Swiss-Prot
Match: YPTC1_CHLRE (GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.243e-13
Identity = 38/50 (76.00%), Postives = 41/50 (82.00%), Query Frame = -2
Query:    6 AKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKGRMASQPSMNNARPP 155
            AKAFADEIGIPF+ETSAK++TNVEQAFM MAA IK RMASQP    A  P
Sbjct:  136 AKAFADEIGIPFLETSAKNATNVEQAFMTMAAEIKNRMASQPIPTKAGGP 185          
BLAST of FK826724 vs. ExPASy Swiss-Prot
Match: YPTV1_VOLCA (GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.624e-13
Identity = 36/44 (81.82%), Postives = 40/44 (90.91%), Query Frame = -2
Query:   30 ETAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKGRMASQP 161
            + AKAFADEIGIPF+ETSAK++TNVEQAFM MAA IK RMASQP
Sbjct:  134 QAAKAFADEIGIPFLETSAKNATNVEQAFMTMAAEIKNRMASQP 177          
BLAST of FK826724 vs. ExPASy Swiss-Prot
Match: RABD1_ARATH (Ras-related protein RABD1 OS=Arabidopsis thaliana GN=RABD1 PE=1 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.543e-11
Identity = 31/52 (59.62%), Postives = 38/52 (73.08%), Query Frame = -2
Query:    6 ETAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKGRMASQPSMNNARPP 161
            ET +A ADE+GIPF+ETSAKDS NVEQAF+ +A  IK +M SQ + N    P
Sbjct:  134 ETGRALADELGIPFLETSAKDSINVEQAFLTIAGEIKKKMGSQTNANKTSGP 185          
BLAST of FK826724 vs. ExPASy Swiss-Prot
Match: RAB1A_LYMST (Ras-related protein Rab-1A OS=Lymnaea stagnalis GN=RAB1A PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.543e-11
Identity = 30/50 (60.00%), Postives = 41/50 (82.00%), Query Frame = -2
Query:    9 TAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKGRMASQPSMNNARP 158
            TAK +AD++GIPF+ETSAK++TNVEQAFM MAA IK RM    + ++++P
Sbjct:  138 TAKEYADQLGIPFLETSAKNATNVEQAFMTMAAEIKNRMGPITAASDSKP 187          
BLAST of FK826724 vs. ExPASy Swiss-Prot
Match: RAB1B_PONAB (Ras-related protein Rab-1B OS=Pongo abelii GN=RAB1B PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.851e-11
Identity = 32/50 (64.00%), Postives = 37/50 (74.00%), Query Frame = -2
Query:    9 TAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKGRMASQPSMNNARP 158
            TAK FAD +GIPF+ETSAK++TNVEQAFM MAA IK RM    +    RP
Sbjct:  135 TAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERP 184          
BLAST of FK826724 vs. ExPASy Swiss-Prot
Match: RAB1B_PIG (Ras-related protein Rab-1B OS=Sus scrofa GN=RAB1B PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.851e-11
Identity = 32/50 (64.00%), Postives = 37/50 (74.00%), Query Frame = -2
Query:    9 TAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKGRMASQPSMNNARP 158
            TAK FAD +GIPF+ETSAK++TNVEQAFM MAA IK RM    +    RP
Sbjct:  135 TAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERP 184          
BLAST of FK826724 vs. ExPASy Swiss-Prot
Match: RAB1B_MACFA (Ras-related protein Rab-1B OS=Macaca fascicularis GN=RAB1B PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.851e-11
Identity = 32/50 (64.00%), Postives = 37/50 (74.00%), Query Frame = -2
Query:    9 TAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKGRMASQPSMNNARP 158
            TAK FAD +GIPF+ETSAK++TNVEQAFM MAA IK RM    +    RP
Sbjct:  135 TAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERP 184          
The following BLAST results are available for this feature:
BLAST of FK826724 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
RBD2A_ARATH3.990e-2090.57Ras-related protein RABD2A OS=Arabidopsis thaliana... [more]
YPTM2_MAIZE1.087e-1783.02GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=... [more]
RIC1_ORYSJ1.918e-1469.81Ras-related protein RIC1 OS=Oryza sativa subsp. ja... [more]
YPTC1_CHLRE1.243e-1376.00GTP-binding protein YPTC1 OS=Chlamydomonas reinhar... [more]
YPTV1_VOLCA1.624e-1381.82GTP-binding protein yptV1 OS=Volvox carteri GN=YPT... [more]
RABD1_ARATH7.543e-1159.62Ras-related protein RABD1 OS=Arabidopsis thaliana ... [more]
RAB1A_LYMST7.543e-1160.00Ras-related protein Rab-1A OS=Lymnaea stagnalis GN... [more]
RAB1B_PONAB9.851e-1164.00Ras-related protein Rab-1B OS=Pongo abelii GN=RAB1... [more]
RAB1B_PIG9.851e-1164.00Ras-related protein Rab-1B OS=Sus scrofa GN=RAB1B ... [more]
RAB1B_MACFA9.851e-1164.00Ras-related protein Rab-1B OS=Macaca fascicularis ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionclone492 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 492, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826724 ID=FK826724|Name=FK826724|organism=Citrus sinensis|type=EST|length=162bp
ACAGTTGGAGGCCTTGCATTGTTCATGGATGGTTGACTTGCCATTCTACC
CTTGATTGAAGCAGCCATGGCCATGAATGCCTGTTCCACGTTGGTAGAAT
CTTTTGCACTAGTTTCCATGAAAGGTATTCCAATTTCATCTGCAAATGCC
TTGGCTGTTTCG
back to top