FK826694

Overview
NameFK826694
Unique NameFK826694
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length484
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FK826694_ssr390 microsatellite FK826694_ssr390:390..409. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig68 contig Csv1_Contig68:390..873. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FK826694 vs. ExPASy Swiss-Prot
Match: YBA9_SCHPO (Uncharacterized protein C119.09c OS=Schizosaccharomyces pombe GN=SPBC119.09c PE=2 SV=3)

HSP 1 Score: 78.9518 bits (193), Expect = 1.241e-14
Identity = 35/93 (37.63%), Postives = 54/93 (58.06%), Query Frame = -3
Query:    3 NRNTEWFTYPGVWTTYLSILFISWLLVLSLFNCSSGMAWTLVHLSHFFVTYHFFHWKKGTPFADDQGIYNGLTWWEQIDNGKQLTRNRKFLTV 281
            N N+ W  Y G W  ++ ++    L+  ++ + S  +AWTL +L++   ++  FHW  GTPF  + G Y+ LT WEQ+D G Q T  RK+L V
Sbjct:   33 NYNSNWVNYKGAWVIHIVLIAALRLIFHAIPSVSRELAWTLTNLTYMAGSFIMFHWVTGTPFEFNGGAYDRLTMWEQLDEGNQYTPARKYLLV 125          
BLAST of FK826694 vs. ExPASy Swiss-Prot
Match: ORML1_MOUSE (ORM1-like protein 1 OS=Mus musculus GN=Ormdl1 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.792e-13
Identity = 41/100 (41.00%), Postives = 57/100 (57.00%), Query Frame = -3
Query:    3 VPPTDLNRNTEWFTYPGVWTTYLSILFISWLLVLSLFNCSSGMAWTLVHLSHFFVTYHFFHWKKGTPF-ADDQGIYNGLTWWEQIDNGKQLTRNRKFLTV 299
            V  +++N NT      G+W TY   + +  +++LS+  CS  +AWTL ++ H    Y F H  KGTPF   DQG    LT WEQ+D G Q T +RKF T+
Sbjct:    5 VAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFCSVPVAWTLTNIIHNLGMYVFLHAVKGTPFETPDQGRARLLTHWEQLDYGVQFTSSRKFFTI 104          
BLAST of FK826694 vs. ExPASy Swiss-Prot
Match: ORML2_HUMAN (ORM1-like protein 2 OS=Homo sapiens GN=ORMDL2 PE=2 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 2.341e-13
Identity = 39/100 (39.00%), Postives = 58/100 (58.00%), Query Frame = -3
Query:    3 VPPTDLNRNTEWFTYPGVWTTYLSILFISWLLVLSLFNCSSGMAWTLVHLSHFFVTYHFFHWKKGTPF-ADDQGIYNGLTWWEQIDNGKQLTRNRKFLTV 299
            V  +++N NT      G+W  Y+ ++ +  +++LS+   S  + WTL ++ H   TY F H  KGTPF   DQG    LT WEQ+D G Q T +RKFL++
Sbjct:    5 VAHSEVNPNTRVMNSRGIWLAYIILVGLLHMVLLSIPFFSIPVVWTLTNVIHNLATYVFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSI 104          
BLAST of FK826694 vs. ExPASy Swiss-Prot
Match: ORML2_BOVIN (ORM1-like protein 2 OS=Bos taurus GN=ORMDL2 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 5.214e-13
Identity = 39/100 (39.00%), Postives = 58/100 (58.00%), Query Frame = -3
Query:    3 VPPTDLNRNTEWFTYPGVWTTYLSILFISWLLVLSLFNCSSGMAWTLVHLSHFFVTYHFFHWKKGTPF-ADDQGIYNGLTWWEQIDNGKQLTRNRKFLTV 299
            V  +++N NT      G+W  Y+ ++ +  +++LS+   S  + WTL ++ H  V Y F H  KGTPF   DQG    LT WEQ+D G Q T +RKFL++
Sbjct:    5 VAHSEVNPNTRVMNSRGIWLAYIILVGLLHVVLLSIPFFSIPVVWTLTNVIHNLVMYVFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSI 104          
BLAST of FK826694 vs. ExPASy Swiss-Prot
Match: ORML3_HUMAN (ORM1-like protein 3 OS=Homo sapiens GN=ORMDL3 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 6.810e-13
Identity = 39/97 (40.21%), Postives = 56/97 (57.73%), Query Frame = -3
Query:    3 TDLNRNTEWFTYPGVWTTYLSILFISWLLVLSLFNCSSGMAWTLVHLSHFFVTYHFFHWKKGTPF-ADDQGIYNGLTWWEQIDNGKQLTRNRKFLTV 290
            +++N NT      G+W +Y+  + +  +++LS+   S  + WTL +L H    Y F H  KGTPF   DQG    LT WEQ+D G Q T +RKFLT+
Sbjct:    8 SEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTI 104          
BLAST of FK826694 vs. ExPASy Swiss-Prot
Match: ORML3_DANRE (ORM1-like protein 3 OS=Danio rerio GN=ormdl3 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 6.810e-13
Identity = 39/97 (40.21%), Postives = 56/97 (57.73%), Query Frame = -3
Query:    3 TDLNRNTEWFTYPGVWTTYLSILFISWLLVLSLFNCSSGMAWTLVHLSHFFVTYHFFHWKKGTPF-ADDQGIYNGLTWWEQIDNGKQLTRNRKFLTV 290
            +++N NT      G+W +Y+  + +  +++LS+   S  + WTL +L H    Y F H  KGTPF   DQG    LT WEQ+D G Q T +RKFLT+
Sbjct:    8 SEVNPNTRVMNSRGIWLSYVLGIGLLHIILLSIPFVSVPVVWTLTNLIHNMCMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTI 104          
BLAST of FK826694 vs. ExPASy Swiss-Prot
Match: ORML3_RAT (ORM1-like protein 3 OS=Rattus norvegicus GN=Ormdl3 PE=2 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 8.894e-13
Identity = 39/97 (40.21%), Postives = 56/97 (57.73%), Query Frame = -3
Query:    3 TDLNRNTEWFTYPGVWTTYLSILFISWLLVLSLFNCSSGMAWTLVHLSHFFVTYHFFHWKKGTPF-ADDQGIYNGLTWWEQIDNGKQLTRNRKFLTV 290
            +++N NT      G+W +Y+  + +  +++LS+   S  + WTL +L H    Y F H  KGTPF   DQG    LT WEQ+D G Q T +RKFLT+
Sbjct:    8 SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNLGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTI 104          
BLAST of FK826694 vs. ExPASy Swiss-Prot
Match: ORML3_PONAB (ORM1-like protein 3 OS=Pongo abelii GN=ORMDL3 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 8.894e-13
Identity = 39/97 (40.21%), Postives = 56/97 (57.73%), Query Frame = -3
Query:    3 TDLNRNTEWFTYPGVWTTYLSILFISWLLVLSLFNCSSGMAWTLVHLSHFFVTYHFFHWKKGTPF-ADDQGIYNGLTWWEQIDNGKQLTRNRKFLTV 290
            +++N NT      G+W +Y+  + +  +++LS+   S  + WTL +L H    Y F H  KGTPF   DQG    LT WEQ+D G Q T +RKFLT+
Sbjct:    8 SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTI 104          
BLAST of FK826694 vs. ExPASy Swiss-Prot
Match: ORML3_MOUSE (ORM1-like protein 3 OS=Mus musculus GN=Ormdl3 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 8.894e-13
Identity = 39/97 (40.21%), Postives = 56/97 (57.73%), Query Frame = -3
Query:    3 TDLNRNTEWFTYPGVWTTYLSILFISWLLVLSLFNCSSGMAWTLVHLSHFFVTYHFFHWKKGTPF-ADDQGIYNGLTWWEQIDNGKQLTRNRKFLTV 290
            +++N NT      G+W +Y+  + +  +++LS+   S  + WTL +L H    Y F H  KGTPF   DQG    LT WEQ+D G Q T +RKFLT+
Sbjct:    8 SEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNLGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTI 104          
BLAST of FK826694 vs. ExPASy Swiss-Prot
Match: ORML2_MOUSE (ORM1-like protein 2 OS=Mus musculus GN=Ormdl2 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.517e-12
Identity = 38/100 (38.00%), Postives = 57/100 (57.00%), Query Frame = -3
Query:    3 VPPTDLNRNTEWFTYPGVWTTYLSILFISWLLVLSLFNCSSGMAWTLVHLSHFFVTYHFFHWKKGTPF-ADDQGIYNGLTWWEQIDNGKQLTRNRKFLTV 299
            V  +++N NT      G+W  Y+ ++ +  +++LS+   S  + WTL ++ H    Y F H  KGTPF   DQG    LT WEQ+D G Q T +RKFL++
Sbjct:    5 VAHSEVNPNTRVMNSRGIWLAYIILVGLLHVVLLSIPFFSIPVVWTLTNVIHNLAMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSI 104          
The following BLAST results are available for this feature:
BLAST of FK826694 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 17
Match NameE-valueIdentityDescription
YBA9_SCHPO1.241e-1437.63Uncharacterized protein C119.09c OS=Schizosaccharo... [more]
ORML1_MOUSE1.792e-1341.00ORM1-like protein 1 OS=Mus musculus GN=Ormdl1 PE=2... [more]
ORML2_HUMAN2.341e-1339.00ORM1-like protein 2 OS=Homo sapiens GN=ORMDL2 PE=2... [more]
ORML2_BOVIN5.214e-1339.00ORM1-like protein 2 OS=Bos taurus GN=ORMDL2 PE=2 S... [more]
ORML3_HUMAN6.810e-1340.21ORM1-like protein 3 OS=Homo sapiens GN=ORMDL3 PE=2... [more]
ORML3_DANRE6.810e-1340.21ORM1-like protein 3 OS=Danio rerio GN=ormdl3 PE=2 ... [more]
ORML3_RAT8.894e-1340.21ORM1-like protein 3 OS=Rattus norvegicus GN=Ormdl3... [more]
ORML3_PONAB8.894e-1340.21ORM1-like protein 3 OS=Pongo abelii GN=ORMDL3 PE=2... [more]
ORML3_MOUSE8.894e-1340.21ORM1-like protein 3 OS=Mus musculus GN=Ormdl3 PE=2... [more]
ORML2_MOUSE1.517e-1238.00ORM1-like protein 2 OS=Mus musculus GN=Ormdl2 PE=2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionclone352 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 352, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826694 ID=FK826694|Name=FK826694|organism=Citrus sinensis|type=EST|length=484bp
ACAACAGTCAAAAACTTTCTATTGCGGGTGAGTTGCTTTCCATTATCAAT
CTGCTCCCACCAGGTCAAGCCGTTGTAAATCCCCTGGTCATCGGCAAAGG
GTGTCCCCTTCTTCCAGTGAAAGAAGTGATAAGTAACGAAAAAATGAGAG
AGATGAACGAGGGTCCAAGCCATGCCGGAAGAGCAATTGAAGAGAGAAAG
AACGAGAAGCCATGATATGAATAGAATGGATAAGTATGTCGTCCATACTC
CTGGATACGTGAACCACTCCGTGTTCCTGTTCAGATCCGTCGGTGGCACT
GTCCTTACATACATCTTCTCTTCTCCTTTCCTCACTAACAATCAACTCTT
CGTCTTCTTTACTTACTCACTATTTATACCTTTTTGCTTTTTCTTTCTTT
CTTTCTTTCCTTCTTTAATCTAATGACGATGATGATGTATGCGTTTCAGA
TTTCAGATTTCAGAGGAAAAAGAAAAAATAAAAG
back to top