FK826692

Overview
NameFK826692
Unique NameFK826692
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length118
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6745 contig Csv1_Contig6745:1259..1376. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FK826692 vs. ExPASy Swiss-Prot
Match: ALF_ORYSJ (Fructose-bisphosphate aldolase cytoplasmic isozyme OS=Oryza sativa subsp. japonica GN=FBA PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 7.299e-14
Identity = 37/39 (94.87%), Postives = 37/39 (94.87%), Query Frame = -2
Query:    1 LSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKG 117
            LSGVILFEETLYQKT  GKPFVDVLKEGGVLPGIKVDKG
Sbjct:   69 LSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKG 107          
BLAST of FK826692 vs. ExPASy Swiss-Prot
Match: ALF2_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 2 OS=Pisum sativum PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.299e-14
Identity = 37/39 (94.87%), Postives = 37/39 (94.87%), Query Frame = -2
Query:    1 LSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKG 117
            LSGVILFEETLYQKTAAGKPFVDVL E GVLPGIKVDKG
Sbjct:   70 LSGVILFEETLYQKTAAGKPFVDVLNEAGVLPGIKVDKG 108          
BLAST of FK826692 vs. ExPASy Swiss-Prot
Match: ALF_MAIZE (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Zea mays PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.245e-13
Identity = 36/39 (92.31%), Postives = 37/39 (94.87%), Query Frame = -2
Query:    1 LSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKG 117
            +SGVILFEETLYQKT  GKPFVDVLKEGGVLPGIKVDKG
Sbjct:   69 ISGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKG 107          
BLAST of FK826692 vs. ExPASy Swiss-Prot
Match: ALF_SPIOL (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.124e-13
Identity = 35/39 (89.74%), Postives = 37/39 (94.87%), Query Frame = -2
Query:    1 LSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKG 117
            LSGVILFEETLYQKTA GKPFVD +K+GGVLPGIKVDKG
Sbjct:   69 LSGVILFEETLYQKTADGKPFVDAMKDGGVLPGIKVDKG 107          
BLAST of FK826692 vs. ExPASy Swiss-Prot
Match: ALF_CICAR (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Cicer arietinum GN=ALDC PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.774e-13
Identity = 36/39 (92.31%), Postives = 36/39 (92.31%), Query Frame = -2
Query:    1 LSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKG 117
            LSGVILFEETLYQ TAAGKPFVDVL E GVLPGIKVDKG
Sbjct:   69 LSGVILFEETLYQSTAAGKPFVDVLNEAGVLPGIKVDKG 107          
BLAST of FK826692 vs. ExPASy Swiss-Prot
Match: ALF_ARATH (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Arabidopsis thaliana GN=At4g26520 PE=2 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 4.005e-12
Identity = 33/39 (84.62%), Postives = 36/39 (92.31%), Query Frame = -2
Query:    1 LSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKG 117
            LSGVILFEETLYQKT+ GKPFVD+L E GV+PGIKVDKG
Sbjct:   69 LSGVILFEETLYQKTSDGKPFVDLLMENGVIPGIKVDKG 107          
BLAST of FK826692 vs. ExPASy Swiss-Prot
Match: ALF1_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.428e-11
Identity = 30/39 (76.92%), Postives = 36/39 (92.31%), Query Frame = -2
Query:    1 LSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKG 117
            LSGVILFEETLYQK++ GKPFV++L+E  V+PGIKVDKG
Sbjct:   69 LSGVILFEETLYQKSSEGKPFVEILQENNVIPGIKVDKG 107          
The following BLAST results are available for this feature:
BLAST of FK826692 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
ALF_ORYSJ7.299e-1494.87Fructose-bisphosphate aldolase cytoplasmic isozyme... [more]
ALF2_PEA7.299e-1494.87Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_MAIZE1.245e-1392.31Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_SPIOL2.124e-1389.74Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_CICAR2.774e-1392.31Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_ARATH4.005e-1284.62Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF1_PEA4.428e-1176.92Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
back to top
Properties
Property NameValue
Genbank descriptionclone348 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 348, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826692 ID=FK826692|Name=FK826692|organism=Citrus sinensis|type=EST|length=118bp
ACCCTTGTCAACCTTAATTCCAGGGAGGACTCCACCCTCCTTCAAGACAT
CAACGAAGGGCTTGCCAGCAGCAGTCTTCTGGTAGAGGGTCTCCTCGAAG
AGGATGACACCACTGAGG
back to top