FK826690

Overview
NameFK826690
Unique NameFK826690
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length255
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FK826690 vs. ExPASy Swiss-Prot
Match: AL2B7_ARATH (Aldehyde dehydrogenase family 2 member B7, mitochondrial OS=Arabidopsis thaliana GN=ALDH2B7 PE=2 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 2.765e-20
Identity = 43/56 (76.79%), Postives = 48/56 (85.71%), Query Frame = 2
Query:    2 LQLAAKSNLKPVTLELGGKSPFIVCEDADVDKAAELAHYALFFNQVCSLQCFCSTS 169
            L+LA+KSNLK VTLELGGKSPFIVCEDADVD+A ELAH+ALFFNQ    QC C+ S
Sbjct:  287 LELASKSNLKAVTLELGGKSPFIVCEDADVDQAVELAHFALFFNQG---QCCCAGS 339          

HSP 2 Score: 32.7278 bits (73), Expect = 2.765e-20
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  219 QGQCCCAGSRTF 254
            QGQCCCAGSRTF
Sbjct:  331 QGQCCCAGSRTF 342          
BLAST of FK826690 vs. ExPASy Swiss-Prot
Match: AL2B4_ARATH (Aldehyde dehydrogenase family 2 member B4, mitochondrial OS=Arabidopsis thaliana GN=ALDH2B4 PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.338e-19
Identity = 43/56 (76.79%), Postives = 46/56 (82.14%), Query Frame = 2
Query:    2 LQLAAKSNLKPVTLELGGKSPFIVCEDADVDKAAELAHYALFFNQVCSLQCFCSTS 169
            L LAA SNLKPVTLELGGKSPFIV EDAD+DKA ELAH+ALFFNQ    QC C+ S
Sbjct:  291 LGLAANSNLKPVTLELGGKSPFIVFEDADIDKAVELAHFALFFNQG---QCCCAGS 343          

HSP 2 Score: 32.7278 bits (73), Expect = 1.338e-19
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  219 QGQCCCAGSRTF 254
            QGQCCCAGSRTF
Sbjct:  335 QGQCCCAGSRTF 346          
BLAST of FK826690 vs. ExPASy Swiss-Prot
Match: ALDH2_PIG (Aldehyde dehydrogenase, mitochondrial OS=Sus scrofa GN=ALDH2 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 1.379e-14
Identity = 35/53 (66.04%), Postives = 39/53 (73.58%), Query Frame = 2
Query:   11 AAKSNLKPVTLELGGKSPFIVCEDADVDKAAELAHYALFFNQVCSLQCFCSTS 169
            A KSNLK VTLELGGKSP I+  DAD+D A E AH+ALFFNQ    QC C+ S
Sbjct:  278 AGKSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQG---QCCCAGS 327          

HSP 2 Score: 32.7278 bits (73), Expect = 1.379e-14
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  219 QGQCCCAGSRTF 254
            QGQCCCAGSRTF
Sbjct:  319 QGQCCCAGSRTF 330          
BLAST of FK826690 vs. ExPASy Swiss-Prot
Match: ALDH2_BOVIN (Aldehyde dehydrogenase, mitochondrial OS=Bos taurus GN=ALDH2 PE=1 SV=2)

HSP 1 Score: 65.855 bits (159), Expect = 1.379e-14
Identity = 35/53 (66.04%), Postives = 39/53 (73.58%), Query Frame = 2
Query:   11 AAKSNLKPVTLELGGKSPFIVCEDADVDKAAELAHYALFFNQVCSLQCFCSTS 169
            A KSNLK VTLELGGKSP I+  DAD+D A E AH+ALFFNQ    QC C+ S
Sbjct:  277 AGKSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQG---QCCCAGS 326          

HSP 2 Score: 32.7278 bits (73), Expect = 1.379e-14
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  219 QGQCCCAGSRTF 254
            QGQCCCAGSRTF
Sbjct:  318 QGQCCCAGSRTF 329          
BLAST of FK826690 vs. ExPASy Swiss-Prot
Match: ALDH2_RAT (Aldehyde dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Aldh2 PE=1 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 5.103e-14
Identity = 34/53 (64.15%), Postives = 38/53 (71.70%), Query Frame = 2
Query:   11 AAKSNLKPVTLELGGKSPFIVCEDADVDKAAELAHYALFFNQVCSLQCFCSTS 169
            A  SNLK VTLELGGKSP I+  DAD+D A E AH+ALFFNQ    QC C+ S
Sbjct:  276 AGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQG---QCCCAGS 325          

HSP 2 Score: 32.7278 bits (73), Expect = 5.103e-14
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  219 QGQCCCAGSRTF 254
            QGQCCCAGSRTF
Sbjct:  317 QGQCCCAGSRTF 328          
BLAST of FK826690 vs. ExPASy Swiss-Prot
Match: ALDH2_PONAB (Aldehyde dehydrogenase, mitochondrial OS=Pongo abelii GN=ALDH2 PE=2 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 5.103e-14
Identity = 34/53 (64.15%), Postives = 38/53 (71.70%), Query Frame = 2
Query:   11 AAKSNLKPVTLELGGKSPFIVCEDADVDKAAELAHYALFFNQVCSLQCFCSTS 169
            A  SNLK VTLELGGKSP I+  DAD+D A E AH+ALFFNQ    QC C+ S
Sbjct:  274 AGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQG---QCCCAGS 323          

HSP 2 Score: 32.7278 bits (73), Expect = 5.103e-14
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  219 QGQCCCAGSRTF 254
            QGQCCCAGSRTF
Sbjct:  315 QGQCCCAGSRTF 326          
BLAST of FK826690 vs. ExPASy Swiss-Prot
Match: ALDH2_MOUSE (Aldehyde dehydrogenase, mitochondrial OS=Mus musculus GN=Aldh2 PE=1 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 5.103e-14
Identity = 34/53 (64.15%), Postives = 38/53 (71.70%), Query Frame = 2
Query:   11 AAKSNLKPVTLELGGKSPFIVCEDADVDKAAELAHYALFFNQVCSLQCFCSTS 169
            A  SNLK VTLELGGKSP I+  DAD+D A E AH+ALFFNQ    QC C+ S
Sbjct:  276 AGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQG---QCCCAGS 325          

HSP 2 Score: 32.7278 bits (73), Expect = 5.103e-14
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  219 QGQCCCAGSRTF 254
            QGQCCCAGSRTF
Sbjct:  317 QGQCCCAGSRTF 328          
BLAST of FK826690 vs. ExPASy Swiss-Prot
Match: ALDH2_HUMAN (Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens GN=ALDH2 PE=1 SV=2)

HSP 1 Score: 63.929 bits (154), Expect = 5.103e-14
Identity = 34/53 (64.15%), Postives = 38/53 (71.70%), Query Frame = 2
Query:   11 AAKSNLKPVTLELGGKSPFIVCEDADVDKAAELAHYALFFNQVCSLQCFCSTS 169
            A  SNLK VTLELGGKSP I+  DAD+D A E AH+ALFFNQ    QC C+ S
Sbjct:  274 AGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQG---QCCCAGS 323          

HSP 2 Score: 32.7278 bits (73), Expect = 5.103e-14
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  219 QGQCCCAGSRTF 254
            QGQCCCAGSRTF
Sbjct:  315 QGQCCCAGSRTF 326          
BLAST of FK826690 vs. ExPASy Swiss-Prot
Match: ALDH2_MESAU (Aldehyde dehydrogenase, mitochondrial OS=Mesocricetus auratus GN=ALDH2 PE=1 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 5.107e-14
Identity = 34/53 (64.15%), Postives = 38/53 (71.70%), Query Frame = 2
Query:   11 AAKSNLKPVTLELGGKSPFIVCEDADVDKAAELAHYALFFNQVCSLQCFCSTS 169
            A  SNLK VTLELGGKSP I+  DAD+D A E AH+ALFFNQ    QC C+ S
Sbjct:  257 AGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQG---QCCCAGS 306          

HSP 2 Score: 32.7278 bits (73), Expect = 5.107e-14
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  219 QGQCCCAGSRTF 254
            QGQCCCAGSRTF
Sbjct:  298 QGQCCCAGSRTF 309          
BLAST of FK826690 vs. ExPASy Swiss-Prot
Match: ALDH_EMENI (Aldehyde dehydrogenase OS=Emericella nidulans GN=aldA PE=3 SV=2)

HSP 1 Score: 64.3142 bits (155), Expect = 2.579e-12
Identity = 34/56 (60.71%), Postives = 40/56 (71.43%), Query Frame = 2
Query:    2 LQLAAKSNLKPVTLELGGKSPFIVCEDADVDKAAELAHYALFFNQVCSLQCFCSTS 169
            LQ AAKSNLK VTLELGGKSP IV +DAD+D A   A++ +FFN     QC C+ S
Sbjct:  250 LQAAAKSNLKKVTLELGGKSPNIVFDDADIDNAISWANFGIFFNHG---QCCCAGS 302          

HSP 2 Score: 26.5646 bits (57), Expect = 2.579e-12
Identity = 9/9 (100.00%), Postives = 9/9 (100.00%), Query Frame = 3
Query:  222 GQCCCAGSR 248
            GQCCCAGSR
Sbjct:  295 GQCCCAGSR 303          
The following BLAST results are available for this feature:
BLAST of FK826690 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 20
Match NameE-valueIdentityDescription
AL2B7_ARATH2.765e-2076.79Aldehyde dehydrogenase family 2 member B7, mitocho... [more]
AL2B4_ARATH1.338e-1976.79Aldehyde dehydrogenase family 2 member B4, mitocho... [more]
ALDH2_PIG1.379e-1466.04Aldehyde dehydrogenase, mitochondrial OS=Sus scrof... [more]
ALDH2_BOVIN1.379e-1466.04Aldehyde dehydrogenase, mitochondrial OS=Bos tauru... [more]
ALDH2_RAT5.103e-1464.15Aldehyde dehydrogenase, mitochondrial OS=Rattus no... [more]
ALDH2_PONAB5.103e-1464.15Aldehyde dehydrogenase, mitochondrial OS=Pongo abe... [more]
ALDH2_MOUSE5.103e-1464.15Aldehyde dehydrogenase, mitochondrial OS=Mus muscu... [more]
ALDH2_HUMAN5.103e-1464.15Aldehyde dehydrogenase, mitochondrial OS=Homo sapi... [more]
ALDH2_MESAU5.107e-1464.15Aldehyde dehydrogenase, mitochondrial OS=Mesocrice... [more]
ALDH_EMENI2.579e-1260.71Aldehyde dehydrogenase OS=Emericella nidulans GN=a... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionclone336 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 336, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826690 ID=FK826690|Name=FK826690|organism=Citrus sinensis|type=EST|length=255bp
ACTTCAATTGGCAGCGAAAAGCAATCTTAAGCCAGTGACATTAGAGCTTG
GAGGGAAATCTCCTTTTATTGTATGTGAAGATGCTGATGTAGATAAGGCC
GCTGAGCTGGCCCACTATGCTTTATTCTTTAATCAGGTATGTTCATTACA
ATGTTTTTGCAGCACCTCGGTTTTTCACGTTTGTTAATGTTTTGTTGATC
ACAATTCTGTGCAATCTGCAGGGACAATGCTGTTGCGCTGGTTCTCGTAC
TTTTG
back to top