FK826688

Overview
NameFK826688
Unique NameFK826688
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length444
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig538 contig Csv1_Contig538:237..680. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FK826688 vs. ExPASy Swiss-Prot
Match: ADF_VITVI (Actin-depolymerizing factor OS=Vitis vinifera PE=2 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 2.104e-49
Identity = 91/112 (81.25%), Postives = 100/112 (89.29%), Query Frame = 2
Query:    2 HRYVIFKIDXXXXXXXXXXTGGPAESYDDFTASLPDNDCRYAVYDFDFVTSENCQKSKIFFIAWSPDVSRIRAKMLYATSKDRFRRELDGIHYEIQATDPSEMDLEVIRDRA 337
            HRYVIFKID          TGGPAES+D+F A+LP+NDCRYAVYDFDFVTSENCQKSKIFFIAWSPD SRIRAKMLYATSK+RFRRELDG+HYEIQATDP+EMDLEV+R+RA
Sbjct:   31 HRYVIFKIDEKKKEVVVEKTGGPAESFDEFAAALPENDCRYAVYDFDFVTSENCQKSKIFFIAWSPDSSRIRAKMLYATSKERFRRELDGVHYEIQATDPTEMDLEVLRERA 142          
BLAST of FK826688 vs. ExPASy Swiss-Prot
Match: ADF11_ORYSJ (Actin-depolymerizing factor 11 OS=Oryza sativa subsp. japonica GN=ADF11 PE=2 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 1.843e-45
Identity = 83/112 (74.11%), Postives = 95/112 (84.82%), Query Frame = 2
Query:    2 HRYVIFKIDXXXXXXXXXXTGGPAESYDDFTASLPDNDCRYAVYDFDFVTSENCQKSKIFFIAWSPDVSRIRAKMLYATSKDRFRRELDGIHYEIQATDPSEMDLEVIRDRA 337
            HRYVIFKID          TG   ES+DDF  SLP++DCRYA+YDFDFVT ENCQKSKIFF+AWSP VSRIRAKMLYATSK+RFRRELDG+HYEIQATDPSE+D+E++R+RA
Sbjct:   33 HRYVIFKIDDKCKEVVVEKTGSSTESFDDFMDSLPESDCRYAIYDFDFVTEENCQKSKIFFVAWSPSVSRIRAKMLYATSKERFRRELDGVHYEIQATDPSELDIELLRERA 144          
BLAST of FK826688 vs. ExPASy Swiss-Prot
Match: ADF6_ARATH (Actin-depolymerizing factor 6 OS=Arabidopsis thaliana GN=ADF6 PE=1 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 9.149e-45
Identity = 84/112 (75.00%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 HRYVIFKIDXXXXXXXXXXTGGPAESYDDFTASLPDNDCRYAVYDFDFVTSENCQKSKIFFIAWSPDVSRIRAKMLYATSKDRFRRELDGIHYEIQATDPSEMDLEVIRDRA 337
            HRYV+FKID          TG P ESYDDF ASLPDNDCRYAVYDFDFVTSENCQKSKIFF AWSP  S IRAK+LY+TSKD+  REL GIHYEIQATDP+E+DLEV+R+RA
Sbjct:   34 HRYVVFKIDESKKEVVVEKTGNPTESYDDFLASLPDNDCRYAVYDFDFVTSENCQKSKIFFFAWSPSTSGIRAKVLYSTSKDQLSRELQGIHYEIQATDPTEVDLEVLRERA 145          
BLAST of FK826688 vs. ExPASy Swiss-Prot
Match: ADF2_ORYSJ (Actin-depolymerizing factor 2 OS=Oryza sativa subsp. japonica GN=ADF2 PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 1.908e-42
Identity = 81/111 (72.97%), Postives = 91/111 (81.98%), Query Frame = 2
Query:    5 RYVIFKIDXXXXXXXXXXTGGPAESYDDFTASLPDNDCRYAVYDFDFVTSENCQKSKIFFIAWSPDVSRIRAKMLYATSKDRFRRELDGIHYEIQATDPSEMDLEVIRDRA 337
            RYVIFKI+          TG   ESYDDF ASLP+NDCRYA+YDFDFVT EN QKSKIFFIAWSP  SRIRAKMLY+TSKDR ++ELDG HYEIQATDP+E+DLEV+R+RA
Sbjct:   34 RYVIFKIEEKQKQVVVEKTGATTESYDDFLASLPENDCRYALYDFDFVTGENVQKSKIFFIAWSPSTSRIRAKMLYSTSKDRIKQELDGFHYEIQATDPTEVDLEVLRERA 144          
BLAST of FK826688 vs. ExPASy Swiss-Prot
Match: ADF10_ORYSJ (Actin-depolymerizing factor 10 OS=Oryza sativa subsp. japonica GN=ADF10 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 5.550e-42
Identity = 78/112 (69.64%), Postives = 91/112 (81.25%), Query Frame = 2
Query:    2 HRYVIFKIDXXXXXXXXXXTGGPAESYDDFTASLPDNDCRYAVYDFDFVTSENCQKSKIFFIAWSPDVSRIRAKMLYATSKDRFRRELDGIHYEIQATDPSEMDLEVIRDRA 337
            HRYVIFKID          TG P ESYDDFTASLP +DCRYAVYD DFV+ +NC+KSKIFFI+WSP VSRIRAK +YA S+++FR ELDG+H+EIQATDP +MDLEV+R RA
Sbjct:   37 HRYVIFKIDDRREEIVVEKTGAPGESYDDFTASLPADDCRYAVYDLDFVSDDNCRKSKIFFISWSPSVSRIRAKTIYAVSRNQFRHELDGVHFEIQATDPDDMDLEVLRGRA 148          
BLAST of FK826688 vs. ExPASy Swiss-Prot
Match: ADF8_ARATH (Actin-depolymerizing factor 8 OS=Arabidopsis thaliana GN=ADF8 PE=2 SV=2)

HSP 1 Score: 163.31 bits (412), Expect = 3.978e-40
Identity = 71/111 (63.96%), Postives = 91/111 (81.98%), Query Frame = 2
Query:    2 HRYVIFKIDXXXXXXXXXXTGGPAESYDDFTASLPDNDCRYAVYDFDFVTSENCQKSKIFFIAWSPDVSRIRAKMLYATSKDRFRRELDGIHYEIQATDPSEMDLEVIRDR 334
            +R+++FKID           G P E+YDDFT+S+PD++CRYAVYDFDF T +NCQKSKIFFIAWSPD SR+R+KMLYA+SKDRF+RE++GI  E+QATDPSEM L++I+ R
Sbjct:   27 YRFIVFKIDEKAQQVQIEKLGNPEETYDDFTSSIPDDECRYAVYDFDFTTEDNCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKREMEGIQVELQATDPSEMSLDIIKGR 137          
BLAST of FK826688 vs. ExPASy Swiss-Prot
Match: ADF10_ARATH (Actin-depolymerizing factor 10 OS=Arabidopsis thaliana GN=ADF10 PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 1.511e-39
Identity = 71/111 (63.96%), Postives = 90/111 (81.08%), Query Frame = 2
Query:    2 HRYVIFKIDXXXXXXXXXXTGGPAESYDDFTASLPDNDCRYAVYDFDFVTSENCQKSKIFFIAWSPDVSRIRAKMLYATSKDRFRRELDGIHYEIQATDPSEMDLEVIRDR 334
            +R+++FKID           G P E+Y+DFT S+P+++CRYAVYD+DF T ENCQKSKIFFIAWSPD SR+R+KMLYA+SKDRF+RELDGI  E+QATDPSEM L++I+ R
Sbjct:   27 YRFIVFKIDEKAQQVMIDKLGNPEETYEDFTRSIPEDECRYAVYDYDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVELQATDPSEMSLDIIKGR 137          
BLAST of FK826688 vs. ExPASy Swiss-Prot
Match: ADF1_PETHY (Actin-depolymerizing factor 1 OS=Petunia hybrida GN=ADF1 PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.974e-39
Identity = 71/112 (63.39%), Postives = 91/112 (81.25%), Query Frame = 2
Query:    2 HRYVIFKIDXXXXXXXXXXTGGPAESYDDFTASLPDNDCRYAVYDFDFVTSENCQKSKIFFIAWSPDVSRIRAKMLYATSKDRFRRELDGIHYEIQATDPSEMDLEVIRDRA 337
            HR++++KI+           G P ESY+DF ASLP+N+CRYAVYDFDFVT+ENCQKS+IFFIAW PD +R+R+KM+YA+SKDRF+RELDGI  E+QA DP+EM L+VI+ RA
Sbjct:   27 HRFIVYKIEEKQKQVVVEKIGEPTESYEDFAASLPENECRYAVYDFDFVTAENCQKSRIFFIAWCPDTARVRSKMIYASSKDRFKRELDGIQVELQACDPTEMGLDVIQSRA 138          
BLAST of FK826688 vs. ExPASy Swiss-Prot
Match: ADF1_ORYSJ (Actin-depolymerizing factor 1 OS=Oryza sativa subsp. japonica GN=ADF1 PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 3.367e-39
Identity = 71/111 (63.96%), Postives = 90/111 (81.08%), Query Frame = 2
Query:    5 RYVIFKIDXXXXXXXXXXTGGPAESYDDFTASLPDNDCRYAVYDFDFVTSENCQKSKIFFIAWSPDVSRIRAKMLYATSKDRFRRELDGIHYEIQATDPSEMDLEVIRDRA 337
            R+++FKI+           G P ESYDDFTA LP ++CRYAV+DFDFVT ENCQKSKIFFI+W+PD SR+R+KMLYA+SKDRF+RELDGI  E+QATDPSEM +++++ RA
Sbjct:   28 RFIVFKINEKVQQVVVDRLGQPGESYDDFTACLPADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVELQATDPSEMSMDIVKSRA 138          
BLAST of FK826688 vs. ExPASy Swiss-Prot
Match: ADF_LILLO (Actin-depolymerizing factor OS=Lilium longiflorum PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 4.398e-39
Identity = 72/111 (64.86%), Postives = 89/111 (80.18%), Query Frame = 2
Query:    5 RYVIFKIDXXXXXXXXXXTGGPAESYDDFTASLPDNDCRYAVYDFDFVTSENCQKSKIFFIAWSPDVSRIRAKMLYATSKDRFRRELDGIHYEIQATDPSEMDLEVIRDRA 337
            R+++FKI+           G P ESYDDFT  LP N+CRYAV+DFDFVT ENCQKSKIFFI+WSPD SR+R+KMLYA++KDRF+RELDGI  E+QATDPSEM +++I+ RA
Sbjct:   28 RFIVFKIEEKVQQVTVERLGQPNESYDDFTECLPPNECRYAVFDFDFVTDENCQKSKIFFISWSPDTSRVRSKMLYASTKDRFKRELDGIQVELQATDPSEMSMDIIKARA 138          
The following BLAST results are available for this feature:
BLAST of FK826688 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 69
Match NameE-valueIdentityDescription
ADF_VITVI2.104e-4981.25Actin-depolymerizing factor OS=Vitis vinifera PE=2... [more]
ADF11_ORYSJ1.843e-4574.11Actin-depolymerizing factor 11 OS=Oryza sativa sub... [more]
ADF6_ARATH9.149e-4575.00Actin-depolymerizing factor 6 OS=Arabidopsis thali... [more]
ADF2_ORYSJ1.908e-4272.97Actin-depolymerizing factor 2 OS=Oryza sativa subs... [more]
ADF10_ORYSJ5.550e-4269.64Actin-depolymerizing factor 10 OS=Oryza sativa sub... [more]
ADF8_ARATH3.978e-4063.96Actin-depolymerizing factor 8 OS=Arabidopsis thali... [more]
ADF10_ARATH1.511e-3963.96Actin-depolymerizing factor 10 OS=Arabidopsis thal... [more]
ADF1_PETHY1.974e-3963.39Actin-depolymerizing factor 1 OS=Petunia hybrida G... [more]
ADF1_ORYSJ3.367e-3963.96Actin-depolymerizing factor 1 OS=Oryza sativa subs... [more]
ADF_LILLO4.398e-3964.86Actin-depolymerizing factor OS=Lilium longiflorum ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionclone288 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 288, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826688 ID=FK826688|Name=FK826688|organism=Citrus sinensis|type=EST|length=444bp
ACATCGGTATGTGATTTTTAAGATTGATGAGAAGAAAAAGGAGGTAGTGG
TTGAAAAGACTGGAGGCCCAGCTGAGAGCTATGACGATTTCACTGCATCT
TTGCCGGATAATGACTGTCGTTATGCAGTTTATGACTTTGATTTTGTGAC
CTCAGAGAATTGTCAGAAAAGCAAGATCTTTTTCATTGCATGGTCTCCTG
ACGTGTCCCGAATCCGAGCTAAGATGCTGTATGCAACATCAAAGGACAGG
TTCAGGAGGGAGCTGGACGGCATCCACTATGAAATTCAGGCAACTGACCC
AAGTGAGATGGATCTTGAGGTGATCAGAGACCGTGCACGCTGAGAATGCC
CTGAAGGAAAAGAATTTGTTTCCTTGAGACTGCATTTGTGGTCTGAAGGC
ACAAACTGTCCTCCAATTAGTTGCCGTATTTGTGTGGCACATAG
back to top