FK826685

Overview
NameFK826685
Unique NameFK826685
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length125
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig472 contig Csv1_Contig472:150..274. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FK826685 vs. ExPASy Swiss-Prot
Match: PX111_ORYSJ (Peroxisomal membrane protein 11-1 OS=Oryza sativa subsp. japonica GN=PEX11-1 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 8.571e-15
Identity = 38/41 (92.68%), Postives = 40/41 (97.56%), Query Frame = 1
Query:    1 TLDATRAELALVVLYLNKAEARDKICRAIQYGSKFLSDGQP 123
            TLDATRAEL LVVLYLNKAEARDKICRAIQYGSKF+S+GQP
Sbjct:    3 TLDATRAELGLVVLYLNKAEARDKICRAIQYGSKFISNGQP 43          
BLAST of FK826685 vs. ExPASy Swiss-Prot
Match: PX11E_ARATH (Peroxisomal membrane protein 11E OS=Arabidopsis thaliana GN=PEX11E PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.462e-14
Identity = 38/41 (92.68%), Postives = 39/41 (95.12%), Query Frame = 1
Query:    1 TLDATRAELALVVLYLNKAEARDKICRAIQYGSKFLSDGQP 123
            TLD TRAELAL+VLYLNKAEARDKICRAIQYGSKFLS GQP
Sbjct:    3 TLDLTRAELALIVLYLNKAEARDKICRAIQYGSKFLSGGQP 43          
BLAST of FK826685 vs. ExPASy Swiss-Prot
Match: PX11C_ARATH (Peroxisomal membrane protein 11C OS=Arabidopsis thaliana GN=PEX11C PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.494e-14
Identity = 37/41 (90.24%), Postives = 39/41 (95.12%), Query Frame = 1
Query:    1 TLDATRAELALVVLYLNKAEARDKICRAIQYGSKFLSDGQP 123
            TL+ TRAEL LVV+YLNKAEARDKICRAIQYGSKFLSDGQP
Sbjct:    3 TLETTRAELGLVVVYLNKAEARDKICRAIQYGSKFLSDGQP 43          
BLAST of FK826685 vs. ExPASy Swiss-Prot
Match: PX11D_ARATH (Peroxisomal membrane protein 11D OS=Arabidopsis thaliana GN=PEX11D PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 7.256e-14
Identity = 36/41 (87.80%), Postives = 39/41 (95.12%), Query Frame = 1
Query:    1 TLDATRAELALVVLYLNKAEARDKICRAIQYGSKFLSDGQP 123
            TLD +RAELALVV+YLNKAEARDK+CRAIQYGSKFLS GQP
Sbjct:    4 TLDVSRAELALVVMYLNKAEARDKLCRAIQYGSKFLSGGQP 44          
BLAST of FK826685 vs. ExPASy Swiss-Prot
Match: PX115_ORYSJ (Peroxisomal membrane protein 11-5 OS=Oryza sativa subsp. japonica GN=PEX11-5 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.787e-12
Identity = 32/41 (78.05%), Postives = 40/41 (97.56%), Query Frame = 1
Query:    1 TLDATRAELALVVLYLNKAEARDKICRAIQYGSKFLSDGQP 123
            +L++ RA+LAL++LYLNKAEARDKICRAIQYGSKF+S+GQP
Sbjct:    3 SLESARADLALLILYLNKAEARDKICRAIQYGSKFVSNGQP 43          
The following BLAST results are available for this feature:
BLAST of FK826685 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
PX111_ORYSJ8.571e-1592.68Peroxisomal membrane protein 11-1 OS=Oryza sativa ... [more]
PX11E_ARATH1.462e-1492.68Peroxisomal membrane protein 11E OS=Arabidopsis th... [more]
PX11C_ARATH2.494e-1490.24Peroxisomal membrane protein 11C OS=Arabidopsis th... [more]
PX11D_ARATH7.256e-1487.80Peroxisomal membrane protein 11D OS=Arabidopsis th... [more]
PX115_ORYSJ1.787e-1278.05Peroxisomal membrane protein 11-5 OS=Oryza sativa ... [more]
back to top
Properties
Property NameValue
Genbank descriptionclone285 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 285, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826685 ID=FK826685|Name=FK826685|organism=Citrus sinensis|type=EST|length=125bp
ACACTGGATGCAACCAGAGCAGAACTTGCACTTGTGGTTTTGTATTTGAA
TAAGGCTGAAGCCAGGGACAAGATATGCAGAGCTATACAATATGGTTCAA
AATTCTTGAGTGATGGACAGCCTGG
back to top