FK826684

Overview
NameFK826684
Unique NameFK826684
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length258
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2038 contig Csv1_Contig2038:412..669. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FK826684 vs. ExPASy Swiss-Prot
Match: G3PC_TOBAC (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic (Fragment) OS=Nicotiana tabacum GN=GAPC PE=2 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 5.974e-40
Identity = 80/86 (93.02%), Postives = 84/86 (97.67%), Query Frame = -1
Query:    1 PTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSKEFVKLVSWYDNEWGYS 258
            PTVDVSVVDLTVRLEK+ASYD+IKAAIK ESEGKLKGILG+TEDDVVSTDFVGD+RSSIFDAKAGIALSK FVKLVSWYDNEWGYS
Sbjct:  227 PTVDVSVVDLTVRLEKEASYDDIKAAIKEESEGKLKGILGFTEDDVVSTDFVGDSRSSIFDAKAGIALSKNFVKLVSWYDNEWGYS 312          
BLAST of FK826684 vs. ExPASy Swiss-Prot
Match: G3PC_GINBI (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Ginkgo biloba PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.738e-39
Identity = 80/86 (93.02%), Postives = 81/86 (94.19%), Query Frame = -1
Query:    1 PTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSKEFVKLVSWYDNEWGYS 258
            PT DVSVVDLTVRLEK ASYDEIKAAIK ESEGKLKGILGYTEDDVVSTDF+GDNRSSIFDAKAGIALS  FVKLVSWYDNEWGYS
Sbjct:  241 PTPDVSVVDLTVRLEKPASYDEIKAAIKEESEGKLKGILGYTEDDVVSTDFIGDNRSSIFDAKAGIALSDNFVKLVSWYDNEWGYS 326          
BLAST of FK826684 vs. ExPASy Swiss-Prot
Match: G3PC_ARATH (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Arabidopsis thaliana GN=GAPC PE=2 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 2.270e-39
Identity = 80/86 (93.02%), Postives = 82/86 (95.35%), Query Frame = -1
Query:    1 PTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSKEFVKLVSWYDNEWGYS 258
            PTVDVSVVDLTVRLEK A+YDEIK AIK ESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALS +FVKLVSWYDNEWGYS
Sbjct:  240 PTVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYS 325          
BLAST of FK826684 vs. ExPASy Swiss-Prot
Match: G3PC_MAGLI (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Magnolia liliiflora GN=GAPC PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 3.872e-39
Identity = 78/86 (90.70%), Postives = 83/86 (96.51%), Query Frame = -1
Query:    1 PTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSKEFVKLVSWYDNEWGYS 258
            PTVDVSVVDLTVRLEK ASY+EIKA IKAESEGKLKGILGYTE+DVVSTDF+GDNRSSIFDAKAGIAL++ FVKLVSWYDNEWGYS
Sbjct:  240 PTVDVSVVDLTVRLEKAASYEEIKAVIKAESEGKLKGILGYTEEDVVSTDFIGDNRSSIFDAKAGIALNEHFVKLVSWYDNEWGYS 325          
BLAST of FK826684 vs. ExPASy Swiss-Prot
Match: G3PC_SINAL (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Sinapis alba GN=GAPC PE=2 SV=2)

HSP 1 Score: 159.073 bits (401), Expect = 6.605e-39
Identity = 79/86 (91.86%), Postives = 81/86 (94.19%), Query Frame = -1
Query:    1 PTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSKEFVKLVSWYDNEWGYS 258
            PTVDVSVVDLTVRLEK A+YDEIK AIK ES+GKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALS  FVKLVSWYDNEWGYS
Sbjct:  240 PTVDVSVVDLTVRLEKAATYDEIKKAIKEESQGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDNFVKLVSWYDNEWGYS 325          
BLAST of FK826684 vs. ExPASy Swiss-Prot
Match: G3P_ATRNU (Glyceraldehyde-3-phosphate dehydrogenase OS=Atriplex nummularia PE=2 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 2.510e-38
Identity = 76/86 (88.37%), Postives = 82/86 (95.35%), Query Frame = -1
Query:    1 PTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSKEFVKLVSWYDNEWGYS 258
            PTVDVSVVDLTVRLEK+A+Y++IKAAIK ESEGK+KGILGYTEDDVVSTDFVGDNRSSIFDAKAGI L+  FVKLVSWYDNEWGYS
Sbjct:  238 PTVDVSVVDLTVRLEKEATYEQIKAAIKEESEGKMKGILGYTEDDVVSTDFVGDNRSSIFDAKAGICLNGNFVKLVSWYDNEWGYS 323          
BLAST of FK826684 vs. ExPASy Swiss-Prot
Match: G3PC_DIACA (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Dianthus caryophyllus GN=GAPC PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 2.510e-38
Identity = 75/86 (87.21%), Postives = 82/86 (95.35%), Query Frame = -1
Query:    1 PTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSKEFVKLVSWYDNEWGYS 258
            PTVDVSVVDLTVR+EK A+Y+++KAAIK ESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIAL+  F+KLVSWYDNEWGYS
Sbjct:  238 PTVDVSVVDLTVRIEKPATYEQVKAAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALNDNFIKLVSWYDNEWGYS 323          
BLAST of FK826684 vs. ExPASy Swiss-Prot
Match: G3PC_ANTMA (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Antirrhinum majus GN=GAPC PE=2 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 3.278e-38
Identity = 77/86 (89.53%), Postives = 82/86 (95.35%), Query Frame = -1
Query:    1 PTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSKEFVKLVSWYDNEWGYS 258
            PTVDVSVVDLTVRLEK A+Y++IKAAIK ESEGKLKGILGYTEDDVVSTDFVGD+RSSIFDAKAGIAL+  FVKLVSWYDNEWGYS
Sbjct:  238 PTVDVSVVDLTVRLEKKATYEQIKAAIKEESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYS 323          
BLAST of FK826684 vs. ExPASy Swiss-Prot
Match: G3PC_PETHY (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Petunia hybrida GN=GAPC PE=2 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 4.281e-38
Identity = 78/86 (90.70%), Postives = 82/86 (95.35%), Query Frame = -1
Query:    1 PTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSKEFVKLVSWYDNEWGYS 258
            PTVDVSVVDLTVRLEK+A+YDEIKAAIK ESEGKLKGI G+TEDDVVSTDF+GDNRSSIFDAKAGIALSK FVKLVSWYDNE GYS
Sbjct:  238 PTVDVSVVDLTVRLEKEATYDEIKAAIKEESEGKLKGIPGHTEDDVVSTDFIGDNRSSIFDAKAGIALSKNFVKLVSWYDNEMGYS 323          
BLAST of FK826684 vs. ExPASy Swiss-Prot
Match: G3PC_CRAPL (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Craterostigma plantagineum GN=GAPC PE=2 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 5.591e-38
Identity = 76/86 (88.37%), Postives = 83/86 (96.51%), Query Frame = -1
Query:    1 PTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSKEFVKLVSWYDNEWGYS 258
            PTVDVSVVDLTV L K+ASYDEIKAAIK ESEGKLKGILGYTE+DVVS+DFVGD+RSSIFDAKAGIALSK+FVK+V+WYDNEWGYS
Sbjct:  238 PTVDVSVVDLTVTLAKEASYDEIKAAIKEESEGKLKGILGYTEEDVVSSDFVGDSRSSIFDAKAGIALSKKFVKIVAWYDNEWGYS 323          
The following BLAST results are available for this feature:
BLAST of FK826684 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 281
Match NameE-valueIdentityDescription
G3PC_TOBAC5.974e-4093.02Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_GINBI1.738e-3993.02Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_ARATH2.270e-3993.02Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_MAGLI3.872e-3990.70Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_SINAL6.605e-3991.86Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3P_ATRNU2.510e-3888.37Glyceraldehyde-3-phosphate dehydrogenase OS=Atripl... [more]
G3PC_DIACA2.510e-3887.21Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_ANTMA3.278e-3889.53Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_PETHY4.281e-3890.70Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_CRAPL5.591e-3888.37Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionclone284 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 284, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826684 ID=FK826684|Name=FK826684|organism=Citrus sinensis|type=EST|length=258bp
ACTGTAGCCCCACTCATTGTCATACCATGAGACAAGCTTCACAAATTCCT
TACTCAAAGCAATACCAGCCTTGGCATCAAAGATACTTGACCTATTGTCA
CCAACAAAGTCGGTGGATACCACATCATCCTCAGTGTATCCCAAGATACC
CTTTAGTTTCCCCTCTGACTCCGCCTTGATGGCAGCTTTGATTTCATCAT
AAGAAGCATCCTTCTCCAGCCTCACTGTGAGGTCAACCACTGAGACATCA
ACAGTGGG
back to top