FK826682

Overview
NameFK826682
Unique NameFK826682
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length113
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5701 contig Csv1_Contig5701:525..637. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FK826682 vs. ExPASy Swiss-Prot
Match: CHMU_ARATH (Chorismate mutase, chloroplastic OS=Arabidopsis thaliana GN=CM1 PE=2 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 3.411e-11
Identity = 26/37 (70.27%), Postives = 35/37 (94.59%), Query Frame = 3
Query:    3 ILKETEKLHSKLGRYQSPDEHPFFPDQLPDPVLPPMQ 113
            ++K TEKLH+K+GR++SPDEHPFFPD LP+P+LPP+Q
Sbjct:  131 MVKGTEKLHAKVGRFKSPDEHPFFPDDLPEPMLPPLQ 167          
The following BLAST results are available for this feature:
BLAST of FK826682 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
CHMU_ARATH3.411e-1170.27Chorismate mutase, chloroplastic OS=Arabidopsis th... [more]
back to top
Properties
Property NameValue
Genbank descriptionclone279 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 279, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826682 ID=FK826682|Name=FK826682|organism=Citrus sinensis|type=EST|length=113bp
ACATACTTAAAGAAACTGAAAAACTTCACTCCAAGTTGGGCCGATACCAA
AGCCCGGATGAGCATCCATTCTTTCCTGATCAACTGCCTGACCCAGTGTT
GCCACCTATGCAG
back to top