FK826678

Overview
NameFK826678
Unique NameFK826678
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length311
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FK826678 vs. ExPASy Swiss-Prot
Match: TAF13_PONAB (Transcription initiation factor TFIID subunit 13 OS=Pongo abelii GN=TAF13 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.447e-16
Identity = 39/75 (52.00%), Postives = 58/75 (77.33%), Query Frame = 1
Query:   85 KRKRGVFQKDLQHMMYGFGDDPNPLPETVALVEDIVVEYASDLAHKAQDLGSKRGKLSVEDFLYLIRKDPPKLNR 309
            KRKR +F K+L+ MMYGFGDD NP  E+V ++ED+V+E+ +++ HKA  +G ++G++ VED ++LIRKDP K  R
Sbjct:   27 KRKR-LFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIG-RQGRVQVEDIVFLIRKDPRKFAR 99          
BLAST of FK826678 vs. ExPASy Swiss-Prot
Match: TAF13_MOUSE (Transcription initiation factor TFIID subunit 13 OS=Mus musculus GN=Taf13 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.447e-16
Identity = 39/75 (52.00%), Postives = 58/75 (77.33%), Query Frame = 1
Query:   85 KRKRGVFQKDLQHMMYGFGDDPNPLPETVALVEDIVVEYASDLAHKAQDLGSKRGKLSVEDFLYLIRKDPPKLNR 309
            KRKR +F K+L+ MMYGFGDD NP  E+V ++ED+V+E+ +++ HKA  +G ++G++ VED ++LIRKDP K  R
Sbjct:   27 KRKR-LFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIG-RQGRVQVEDIVFLIRKDPRKFAR 99          
BLAST of FK826678 vs. ExPASy Swiss-Prot
Match: TAF13_HUMAN (Transcription initiation factor TFIID subunit 13 OS=Homo sapiens GN=TAF13 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.447e-16
Identity = 39/75 (52.00%), Postives = 58/75 (77.33%), Query Frame = 1
Query:   85 KRKRGVFQKDLQHMMYGFGDDPNPLPETVALVEDIVVEYASDLAHKAQDLGSKRGKLSVEDFLYLIRKDPPKLNR 309
            KRKR +F K+L+ MMYGFGDD NP  E+V ++ED+V+E+ +++ HKA  +G ++G++ VED ++LIRKDP K  R
Sbjct:   27 KRKR-LFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIG-RQGRVQVEDIVFLIRKDPRKFAR 99          
BLAST of FK826678 vs. ExPASy Swiss-Prot
Match: TAF13_BOVIN (Transcription initiation factor TFIID subunit 13 OS=Bos taurus GN=TAF13 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.447e-16
Identity = 39/75 (52.00%), Postives = 58/75 (77.33%), Query Frame = 1
Query:   85 KRKRGVFQKDLQHMMYGFGDDPNPLPETVALVEDIVVEYASDLAHKAQDLGSKRGKLSVEDFLYLIRKDPPKLNR 309
            KRKR +F K+L+ MMYGFGDD NP  E+V ++ED+V+E+ +++ HKA  +G ++G++ VED ++LIRKDP K  R
Sbjct:   27 KRKR-LFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIG-RQGRVQVEDIVFLIRKDPRKFAR 99          
BLAST of FK826678 vs. ExPASy Swiss-Prot
Match: TAF13_DICDI (Transcription initiation factor TFIID subunit 13 OS=Dictyostelium discoideum GN=taf13 PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.811e-15
Identity = 38/77 (49.35%), Postives = 54/77 (70.13%), Query Frame = 1
Query:   79 SFKRKRGVFQKDLQHMMYGFGDDPNPLPETVALVEDIVVEYASDLAHKAQDLGSKRGKLSVEDFLYLIRKDPPKLNR 309
            S KRKR +F K+L+HMMYGFGD   PL E++ L+E++V E+  ++  KA  + +KRGK   ED ++L+RKDP K  R
Sbjct:    2 STKRKR-MFSKELKHMMYGFGDVREPLHESIDLLEELVFEFIQEMTLKAAQVSNKRGKFQTEDLVFLVRKDPKKYYR 77          
BLAST of FK826678 vs. ExPASy Swiss-Prot
Match: TAF13_SCHPO (Transcription initiation factor TFIID subunit 13 OS=Schizosaccharomyces pombe GN=taf13 PE=2 SV=3)

HSP 1 Score: 74.7146 bits (182), Expect = 1.601e-13
Identity = 31/74 (41.89%), Postives = 52/74 (70.27%), Query Frame = 1
Query:   88 RKRGVFQKDLQHMMYGFGDDPNPLPETVALVEDIVVEYASDLAHKAQDLGSKRGKLSVEDFLYLIRKDPPKLNR 309
            R++ +F KDL+ +MY FGDD NP P+++ ++E+IVV+Y +++  +A  +   R K+ V+DF + +R DP KL R
Sbjct:   13 RRQHLFTKDLKSLMYAFGDDVNPAPDSINVLEEIVVDYINEMCLEAARIAGNRNKVKVDDFKFALRDDPKKLGR 86          
The following BLAST results are available for this feature:
BLAST of FK826678 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
TAF13_PONAB3.447e-1652.00Transcription initiation factor TFIID subunit 13 O... [more]
TAF13_MOUSE3.447e-1652.00Transcription initiation factor TFIID subunit 13 O... [more]
TAF13_HUMAN3.447e-1652.00Transcription initiation factor TFIID subunit 13 O... [more]
TAF13_BOVIN3.447e-1652.00Transcription initiation factor TFIID subunit 13 O... [more]
TAF13_DICDI3.811e-1549.35Transcription initiation factor TFIID subunit 13 O... [more]
TAF13_SCHPO1.601e-1341.89Transcription initiation factor TFIID subunit 13 O... [more]
back to top
Properties
Property NameValue
Genbank descriptionclone272 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 272, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826678 ID=FK826678|Name=FK826678|organism=Citrus sinensis|type=EST|length=311bp
ACATATAAGATGAGCAACCCTTCTGCGGGACAATCCTCAAAATCAAAAGC
GGGATCCTCGCAGCCCTGTGAAACAACTTCGTTTAAGCGCAAGCGAGGAG
TCTTTCAAAAAGATCTCCAGCACATGATGTATGGTTTTGGCGATGATCCT
AATCCACTTCCAGAAACTGTAGCGCTTGTGGAGGACATAGTTGTGGAGTA
TGCCTCAGATTTGGCACACAAAGCGCAAGATCTTGGTTCAAAGAGAGGAA
AGTTATCTGTTGAAGATTTTCTTTACCTAATTCGAAAGGACCCACCGAAA
CTTAACCGCTG
back to top