FK826638

Overview
NameFK826638
Unique NameFK826638
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length240
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FK826638 vs. ExPASy Swiss-Prot
Match: SPX2_BOVIN (Sugar phosphate exchanger 2 OS=Bos taurus GN=SLC37A2 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.400e-11
Identity = 33/71 (46.48%), Postives = 41/71 (57.75%), Query Frame = 3
Query:    3 WLPFYLSQTEIGGEYLSVKTAGNLSTLFDVGGIFGGIIADYISDKLKARATTAATFMYAVIPSMLLYRAYG 215
            WLP Y+S       + + K AG+LSTLFDVGGI GGI+A  +SD +  RATT    +    P M LY   G
Sbjct:  307 WLPLYISNVV----HFTAKEAGDLSTLFDVGGIIGGILAGLVSDYINGRATTCCVMLILAAPMMFLYNHVG 373          
BLAST of FK826638 vs. ExPASy Swiss-Prot
Match: GLPT_HUMAN (Glycerol-3-phosphate transporter OS=Homo sapiens GN=SLC37A1 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.400e-11
Identity = 31/67 (46.27%), Postives = 44/67 (65.67%), Query Frame = 3
Query:    3 WLPFYLSQTEIGGEYLSVKTAGNLSTLFDVGGIFGGIIADYISDKLKARATTAATFMYAVIPSMLLY 203
            WLP Y++  +    +L  K AG LSTLFDVGGIFGGI+A  ISD+L+ RA+T    +    P++ ++
Sbjct:  349 WLPLYITNVD----HLDAKKAGELSTLFDVGGIFGGILAGVISDRLEKRASTCGLMLLLAAPTLYIF 411          
BLAST of FK826638 vs. ExPASy Swiss-Prot
Match: SPX2_HUMAN (Sugar phosphate exchanger 2 OS=Homo sapiens GN=SLC37A2 PE=2 SV=2)

HSP 1 Score: 66.2402 bits (160), Expect = 5.746e-11
Identity = 33/71 (46.48%), Postives = 40/71 (56.34%), Query Frame = 3
Query:    3 WLPFYLSQTEIGGEYLSVKTAGNLSTLFDVGGIFGGIIADYISDKLKARATTAATFMYAVIPSMLLYRAYG 215
            WLP Y++       + S K AG+LSTLFDVGGI GGI+A  +SD    RATT    +    P M LY   G
Sbjct:  317 WLPLYIANVA----HFSAKEAGDLSTLFDVGGIIGGIVAGLVSDYTNGRATTCCVMLILAAPMMFLYNYIG 383          
BLAST of FK826638 vs. ExPASy Swiss-Prot
Match: SPX2_MOUSE (Sugar phosphate exchanger 2 OS=Mus musculus GN=Slc37a2 PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.802e-11
Identity = 36/79 (45.57%), Postives = 43/79 (54.43%), Query Frame = 3
Query:    3 WLPFYLSQTEIGGEYLSVKTAGNLSTLFDVGGIFGGIIADYISDKLKARATTAATFMYAVIPSMLLYRAYGSVSQTVNI 239
            WLP Y+        + S K AG+LSTLFDVGGI GGI+A  ISD   +RATT    +    P M LY   G    T +I
Sbjct:  317 WLPLYIFNVA----HFSAKEAGDLSTLFDVGGIIGGIMAGLISDYTNSRATTCCIMLILAAPMMFLYNYIGQNGITSSI 391          
The following BLAST results are available for this feature:
BLAST of FK826638 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
SPX2_BOVIN4.400e-1146.48Sugar phosphate exchanger 2 OS=Bos taurus GN=SLC37... [more]
GLPT_HUMAN4.400e-1146.27Glycerol-3-phosphate transporter OS=Homo sapiens G... [more]
SPX2_HUMAN5.746e-1146.48Sugar phosphate exchanger 2 OS=Homo sapiens GN=SLC... [more]
SPX2_MOUSE9.802e-1145.57Sugar phosphate exchanger 2 OS=Mus musculus GN=Slc... [more]
back to top
Properties
Property NameValue
Genbank descriptionclone417 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 417, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826638 ID=FK826638|Name=FK826638|organism=Citrus sinensis|type=EST|length=240bp
ACTGGTTACCATTTTATTTGAGTCAGACAGAAATTGGTGGAGAGTATTTA
TCTGTCAAGACTGCTGGAAACCTCTCCACCCTTTTTGATGTAGGTGGAAT
TTTTGGTGGAATTATTGCTGACTACATATCTGATAAACTTAAAGCTCGAG
CTACTACAGCAGCCACCTTCATGTATGCTGTTATTCCATCCATGCTTTTG
TATCGCGCATATGGAAGTGTATCTCAGACAGTCAACATTG
back to top