FK826636

Overview
NameFK826636
Unique NameFK826636
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length339
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12878 contig Csv1_Contig12878:469..807. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FK826636 vs. ExPASy Swiss-Prot
Match: DDI1_CRYNE (DNA damage-inducible protein 1 OS=Cryptococcus neoformans GN=DDI1 PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 3.676e-34
Identity = 65/111 (58.56%), Postives = 88/111 (79.28%), Query Frame = -2
Query:    6 VDMEVNGIPSKAFVDSGAQSTIISKSCAERCGLLKLLDDRYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVLRVGGGEV 338
            +++EVNG P KAFVDSGAQ+TIIS  CAE+CG+++LLD R+ G+A GVG + ILGRIH A IK+G+++ PC+F VL+  +++ LFGLDML++HQC IDL  N LR+   EV
Sbjct:  198 INVEVNGHPVKAFVDSGAQTTIISPECAEQCGIMRLLDTRFAGMAEGVGTARILGRIHSAQIKLGSLYLPCAFSVLEGRSVDLLFGLDMLKRHQCCIDLSTNTLRINNTEV 308          
BLAST of FK826636 vs. ExPASy Swiss-Prot
Match: DDI1_ASHGO (DNA damage-inducible protein 1 OS=Ashbya gossypii GN=DDI1 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.544e-32
Identity = 65/108 (60.19%), Postives = 87/108 (80.56%), Query Frame = -2
Query:   15 VDMEVNGIPSKAFVDSGAQSTIISKSCAERCGLLKLLDDRYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVLRVGG 338
            ++ME+NG P KAFVDSGAQSTI+S + AER GL +L+D R+RG+A GVG+ EI+GR+H A +KI   F PCSF+VLD+ N++ L GLDMLR++Q  +DLKENVL++ G
Sbjct:  265 INMEINGHPVKAFVDSGAQSTIMSTALAERTGLGRLVDKRFRGIARGVGKGEIIGRVHAAQVKIETQFIPCSFIVLDT-NVDLLLGLDMLRRYQACVDLKENVLKIAG 371          
BLAST of FK826636 vs. ExPASy Swiss-Prot
Match: YD27_SCHPO (Uncharacterized protein C56F8.07 OS=Schizosaccharomyces pombe GN=SPAC56F8.07 PE=2 SV=2)

HSP 1 Score: 137.117 bits (344), Expect = 2.634e-32
Identity = 62/111 (55.86%), Postives = 88/111 (79.28%), Query Frame = -2
Query:    6 VDMEVNGIPSKAFVDSGAQSTIISKSCAERCGLLKLLDDRYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVLRVGGGEV 338
            V++E+NG   KAFVDSGAQ+TI+S  CAE+CGL +LLD R++GVA GVG ++ILG +H AP+KIG+++ PC F V++  +++ L GLDMLR++Q  IDL+ NVLR+ G E+
Sbjct:  288 VNVEINGHKVKAFVDSGAQATILSADCAEKCGLTRLLDTRFQGVAKGVGMAKILGCVHSAPLKIGDLYLPCRFTVIEGRDVDMLLGLDMLRRYQACIDLENNVLRIHGKEI 398          
BLAST of FK826636 vs. ExPASy Swiss-Prot
Match: MUD1_SCHPO (UBA domain-containing protein mud1 OS=Schizosaccharomyces pombe GN=mud1 PE=1 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 2.634e-32
Identity = 62/111 (55.86%), Postives = 88/111 (79.28%), Query Frame = -2
Query:    6 VDMEVNGIPSKAFVDSGAQSTIISKSCAERCGLLKLLDDRYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVLRVGGGEV 338
            V++E+NG   KAFVDSGAQ+TI+S  CAE+CGL +LLD R++GVA GVG ++ILG +H AP+KIG+++ PC F V++  +++ L GLDMLR++Q  IDL+ NVLR+ G E+
Sbjct:  113 VNVEINGHKVKAFVDSGAQATILSADCAEKCGLTRLLDTRFQGVAKGVGMAKILGCVHSAPLKIGDLYLPCRFTVIEGRDVDMLLGLDMLRRYQACIDLENNVLRIHGKEI 223          
BLAST of FK826636 vs. ExPASy Swiss-Prot
Match: DDI1_KLULA (DNA damage-inducible protein 1 OS=Kluyveromyces lactis GN=DDI1 PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.708e-31
Identity = 68/110 (61.82%), Postives = 80/110 (72.73%), Query Frame = -2
Query:    9 VDMEVNGIPSKAFVDSGAQSTIISKSCAERCGLLKLLDDRYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVLRVGGGE 338
            + +E+NG P KAFVDSGAQ TI+S   AER GL  L+D R+ G+A GVG  +ILGRIH   IKI +VF PCSF VLD+P ME L GLDMLR+HQ  IDLK NVLR+   E
Sbjct:  203 IKLEINGHPVKAFVDSGAQQTIMSTKLAERTGLTSLIDKRFSGIAQGVGTGKILGRIHTTQIKIHDVFLPCSFTVLDTP-MEMLLGLDMLRRHQASIDLKNNVLRISDVE 311          
BLAST of FK826636 vs. ExPASy Swiss-Prot
Match: DDI2_DANRE (Protein DDI1 homolog 2 OS=Danio rerio GN=ddi2 PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 4.968e-31
Identity = 59/107 (55.14%), Postives = 84/107 (78.50%), Query Frame = -2
Query:   18 VDMEVNGIPSKAFVDSGAQSTIISKSCAERCGLLKLLDDRYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVLRVG 338
            ++ +VNG P KAFVDSGAQ TI+S++CAERC +++L+D R+ G+A GVG  +I+GR+H+A ++I   F PCSF +L+   M+ L GLDML++HQC IDLK+NVL +G
Sbjct:  248 INCKVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEDQPMDMLLGLDMLKRHQCSIDLKKNVLLIG 354          
BLAST of FK826636 vs. ExPASy Swiss-Prot
Match: DDI1_NEUCR (DNA damage-inducible protein 1 OS=Neurospora crassa GN=ddi-1 PE=3 SV=2)

HSP 1 Score: 132.88 bits (333), Expect = 4.968e-31
Identity = 59/111 (53.15%), Postives = 85/111 (76.58%), Query Frame = -2
Query:    6 VDMEVNGIPSKAFVDSGAQSTIISKSCAERCGLLKLLDDRYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVLRVGGGEV 338
            +D+EVNG   KA VDSGAQ+TI+S   AE CG+++L+D RY G+A GVG ++I+GR+H AP+KIG++F PCSF V++  N++ L GLDML+++Q  IDL +N L + G E+
Sbjct:  206 LDVEVNGAKVKALVDSGAQATIMSPDIAEACGIMRLVDKRYGGIAKGVGTAKIIGRVHTAPVKIGSLFLPCSFTVMEGKNVDMLLGLDMLKRYQACIDLAKNALVIQGEEI 316          
BLAST of FK826636 vs. ExPASy Swiss-Prot
Match: DDI2_HUMAN (Protein DDI1 homolog 2 OS=Homo sapiens GN=DDI2 PE=1 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 6.489e-31
Identity = 59/107 (55.14%), Postives = 84/107 (78.50%), Query Frame = -2
Query:   18 VDMEVNGIPSKAFVDSGAQSTIISKSCAERCGLLKLLDDRYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVLRVG 338
            ++ +VNG P KAFVDSGAQ TI+S++CAERC +++L+D R+ G+A GVG  +I+GR+H+A ++I   F PCSF +L+   M+ L GLDML++HQC IDLK+NVL +G
Sbjct:  238 INCKVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVLVIG 344          
BLAST of FK826636 vs. ExPASy Swiss-Prot
Match: DDI1_PHANO (DNA damage-inducible protein 1 OS=Phaeosphaeria nodorum GN=DDI1 PE=3 SV=2)

HSP 1 Score: 131.339 bits (329), Expect = 1.446e-30
Identity = 58/104 (55.77%), Postives = 82/104 (78.85%), Query Frame = -2
Query:   27 VDMEVNGIPSKAFVDSGAQSTIISKSCAERCGLLKLLDDRYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVL 338
            ++ EVNG+P KAFVDSGAQ+TI+S  CAERCG+++L+D RY G+A GVG + ILGR+H A IKIG    PC+F V++  +++ LFGLDML++++  IDL++N L
Sbjct:  206 INTEVNGVPVKAFVDSGAQATIMSPDCAERCGIMRLMDTRYAGMARGVGTARILGRVHHAEIKIGGAVMPCAFTVMEGKDVDLLFGLDMLKRYKAKIDLEKNAL 309          
BLAST of FK826636 vs. ExPASy Swiss-Prot
Match: DDI2_XENTR (Protein DDI1 homolog 2 OS=Xenopus tropicalis GN=ddi2 PE=2 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 1.888e-30
Identity = 58/107 (54.21%), Postives = 84/107 (78.50%), Query Frame = -2
Query:   18 VDMEVNGIPSKAFVDSGAQSTIISKSCAERCGLLKLLDDRYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVLRVG 338
            ++ +VNG P KAFVDSGAQ TI+S++CAERC +++L+D R+ G+A GVG  +I+GR+H+A ++I   F PCSF +L+   M+ L GLDML++HQC IDL++NVL +G
Sbjct:  233 INCKVNGYPVKAFVDSGAQMTIMSQACAERCHIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEEQPMDMLLGLDMLKRHQCSIDLEKNVLVIG 339          
The following BLAST results are available for this feature:
BLAST of FK826636 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 30
Match NameE-valueIdentityDescription
DDI1_CRYNE3.676e-3458.56DNA damage-inducible protein 1 OS=Cryptococcus neo... [more]
DDI1_ASHGO1.544e-3260.19DNA damage-inducible protein 1 OS=Ashbya gossypii ... [more]
YD27_SCHPO2.634e-3255.86Uncharacterized protein C56F8.07 OS=Schizosaccharo... [more]
MUD1_SCHPO2.634e-3255.86UBA domain-containing protein mud1 OS=Schizosaccha... [more]
DDI1_KLULA1.708e-3161.82DNA damage-inducible protein 1 OS=Kluyveromyces la... [more]
DDI2_DANRE4.968e-3155.14Protein DDI1 homolog 2 OS=Danio rerio GN=ddi2 PE=2... [more]
DDI1_NEUCR4.968e-3153.15DNA damage-inducible protein 1 OS=Neurospora crass... [more]
DDI2_HUMAN6.489e-3155.14Protein DDI1 homolog 2 OS=Homo sapiens GN=DDI2 PE=... [more]
DDI1_PHANO1.446e-3055.77DNA damage-inducible protein 1 OS=Phaeosphaeria no... [more]
DDI2_XENTR1.888e-3054.21Protein DDI1 homolog 2 OS=Xenopus tropicalis GN=dd... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionclone413 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 413, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826636 ID=FK826636|Name=FK826636|organism=Citrus sinensis|type=EST|length=339bp
ACTGAAACCTCTCCTCCACCAACTCTTAAGACATTCTCTTTTAGATCAAT
GATACACTGGTGCTTGCGGAGCATATCTAGTCCAAAGAGGAACTCCATGT
TGGGAGAGTCCAACACGACAAATGAACATGGGTAGAATACATTGCCAATC
TTGATTGGAGCAACGTGTATTCGACCAAGAATCTCTGATTGACCAACTCC
ATGAGCAACACCTCTATAACGATCATCTAGAAGCTTCAGCAATCCACAAC
GCTCTGCACAGCTTTTTGATATAATTGTTGACTGTGCACCACTATCTACA
AATGCCTTCGAAGGAATACCATTAACCTCCATGTCAACG
back to top