FK826633

Overview
NameFK826633
Unique NameFK826633
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length169
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FK826633 vs. ExPASy Swiss-Prot
Match: PTBP2_ARATH (Polypyrimidine tract-binding protein homolog 2 OS=Arabidopsis thaliana GN=At5g53180 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 1.902e-22
Identity = 47/55 (85.45%), Postives = 55/55 (100.00%), Query Frame = -3
Query:    3 LRITYSAHTDLSVKFQSHRSRDYTNPYLPVAPSAIDASGQLSVGLDGKKLEPESN 167
            L+ITYSAHTDL+VKFQSHRSRDYTNPYLPVAPSAID++GQ++VG+DGKK+EPESN
Sbjct:  190 LKITYSAHTDLTVKFQSHRSRDYTNPYLPVAPSAIDSTGQVAVGVDGKKMEPESN 244          
BLAST of FK826633 vs. ExPASy Swiss-Prot
Match: PTBP1_ARATH (Polypyrimidine tract-binding protein homolog 1 OS=Arabidopsis thaliana GN=PTB PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 2.660e-16
Identity = 38/55 (69.09%), Postives = 48/55 (87.27%), Query Frame = -3
Query:    3 LRITYSAHTDLSVKFQSHRSRDYTNPYLPVAPSAIDASGQLSVGLDGKKLEPESN 167
            LR++YSAHTDL++KFQSHRSRDYTNPYLPV  +A+D S Q ++G DGKK+E +SN
Sbjct:  189 LRMSYSAHTDLNIKFQSHRSRDYTNPYLPVNQTAMDGSMQPALGADGKKVESQSN 243          
The following BLAST results are available for this feature:
BLAST of FK826633 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
PTBP2_ARATH1.902e-2285.45Polypyrimidine tract-binding protein homolog 2 OS=... [more]
PTBP1_ARATH2.660e-1669.09Polypyrimidine tract-binding protein homolog 1 OS=... [more]
back to top
Properties
Property NameValue
Genbank descriptionclone399 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 399, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826633 ID=FK826633|Name=FK826633|organism=Citrus sinensis|type=EST|length=169bp
ACATTGCTCTCAGGTTCTAGTTTCTTTCCATCAAGACCAACGCTCAACTG
GCCGCTAGCATCTATGGCCGATGGAGCAACAGGAAGGTAAGGATTAGTGT
AGTCCCTGCTACGGTGGCTCTGAAATTTCACACTCAAGTCTGTGTGAGCA
GAATATGTAATCCTTAGGG
back to top