FK826629

Overview
NameFK826629
Unique NameFK826629
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length463
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SINA3_ARATH (E3 ubiquitin-protein ligase SINAT3 OS=Arabidopsis thaliana GN=SINAT3 PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 9.403e-62
Identity = 103/115 (89.57%), Postives = 110/115 (95.65%), Query Frame = 2
Query:    2 HNRCPTCRQELGDIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHKVDMHTGCTFNHRYVKSNPREVENATWMLTV 346
            HNRCPTCRQELGDIRCLALEKVAESLELPCK+  LGCPE+FPYYSKLKHE +C FRPY+CPYAGS+CSV GDIP+LVAHLRDDHKVDMH+GCTFNHRYVKSNPREVENATWMLTV
Sbjct:   92 HNRCPTCRQELGDIRCLALEKVAESLELPCKHMSLGCPEIFPYYSKLKHETVCNFRPYSCPYAGSECSVTGDIPFLVAHLRDDHKVDMHSGCTFNHRYVKSNPREVENATWMLTV 206          
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SINA4_ARATH (E3 ubiquitin-protein ligase SINAT4 OS=Arabidopsis thaliana GN=SINAT4 PE=2 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 1.604e-61
Identity = 102/115 (88.70%), Postives = 110/115 (95.65%), Query Frame = 2
Query:    2 HNRCPTCRQELGDIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHKVDMHTGCTFNHRYVKSNPREVENATWMLTV 346
            HNRCPTCRQELGDIRCLALEKVAESLELPCK+Y+LGCPE+FPYYSKLKHE +C FRPY+CPYAGS+C +VGDIP+LVAHLRDDHKVDMH G TFNHRYVKSNPREVENATWMLTV
Sbjct:   93 HNRCPTCRQELGDIRCLALEKVAESLELPCKFYNLGCPEIFPYYSKLKHESLCNFRPYSCPYAGSECGIVGDIPFLVAHLRDDHKVDMHAGSTFNHRYVKSNPREVENATWMLTV 207          
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SINA5_ARATH (E3 ubiquitin-protein ligase SINAT5 OS=Arabidopsis thaliana GN=SINAT5 PE=1 SV=2)

HSP 1 Score: 230.72 bits (587), Expect = 2.316e-60
Identity = 102/115 (88.70%), Postives = 108/115 (93.91%), Query Frame = 2
Query:    2 HNRCPTCRQELGDIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHKVDMHTGCTFNHRYVKSNPREVENATWMLTV 346
            HNRCPTCRQELGDIRCLALEKVAESLELPCKYY+LGC  +FPYYSKLKHE  C FRPY+CPYAGS+C+ VGDI +LVAHLRDDHKVDMHTGCTFNHRYVKSNPREVENATWMLTV
Sbjct:   75 HNRCPTCRQELGDIRCLALEKVAESLELPCKYYNLGCLGIFPYYSKLKHESQCNFRPYSCPYAGSECAAVGDITFLVAHLRDDHKVDMHTGCTFNHRYVKSNPREVENATWMLTV 189          
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SINA2_ARATH (E3 ubiquitin-protein ligase SINAT2 OS=Arabidopsis thaliana GN=SINAT2 PE=2 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 1.454e-54
Identity = 93/114 (81.58%), Postives = 101/114 (88.60%), Query Frame = 2
Query:    5 NRCPTCRQELGDIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHKVDMHTGCTFNHRYVKSNPREVENATWMLTV 346
            N CPTCR ELG+IRCLALEKVAESLE+PC+Y +LGC ++FPYYSKLKHE  C FRPY CPYAGS+CSV GDIP LV HL+DDHKVDMH GCTFNHRYVKSNP EVENATWMLTV
Sbjct:   90 NTCPTCRYELGNIRCLALEKVAESLEVPCRYQNLGCHDIFPYYSKLKHEQHCRFRPYTCPYAGSECSVTGDIPTLVVHLKDDHKVDMHDGCTFNHRYVKSNPHEVENATWMLTV 203          
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SINA1_ARATH (Putative E3 ubiquitin-protein ligase SINAT1 OS=Arabidopsis thaliana GN=SINAT1 PE=2 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 1.231e-53
Identity = 92/114 (80.70%), Postives = 101/114 (88.60%), Query Frame = 2
Query:    5 NRCPTCRQELGDIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHKVDMHTGCTFNHRYVKSNPREVENATWMLTV 346
            N CPTCR ELG+IRCLALEKVAESLE+PC+Y +LGC ++FPYYSKLKHE  C FR Y+CPYAGS+CSV GDIP LV HL+DDHKVDMH GCTFNHRYVKSNP EVENATWMLTV
Sbjct:   87 NTCPTCRYELGNIRCLALEKVAESLEVPCRYQNLGCQDIFPYYSKLKHEQHCRFRSYSCPYAGSECSVTGDIPTLVDHLKDDHKVDMHDGCTFNHRYVKSNPHEVENATWMLTV 200          
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SINA_SCHMA (E3 ubiquitin-protein ligase sina OS=Schistosoma mansoni GN=SINA PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.984e-19
Identity = 41/82 (50.00%), Postives = 54/82 (65.85%), Query Frame = 2
Query:   11 CPTCRQELGDIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHK 256
            CPTCR  L +IR LA+EK+A S+  PCKY   GCPE F Y SK +HE  C +RPY+CP  G+ C  +G++  ++ HL   HK
Sbjct:  157 CPTCRGNLDNIRNLAMEKLASSVLFPCKYSTSGCPETFHYTSKSEHEAACEYRPYDCPCPGASCKWLGELEQVMPHLVHHHK 238          
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SIAH1_RAT (E3 ubiquitin-protein ligase SIAH1 OS=Rattus norvegicus GN=Siah1 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 3.741e-18
Identity = 40/82 (48.78%), Postives = 50/82 (60.98%), Query Frame = 2
Query:   11 CPTCRQELGDIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHK 256
            CPTCR  LG IR LA+EKVA S+  PCKY   GC    P+  K +HE +C FRPY+CP  G+ C   G +  ++ HL   HK
Sbjct:   72 CPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHK 153          
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SIAH1_DANRE (E3 ubiquitin-protein ligase Siah1 OS=Danio rerio GN=siah1 PE=2 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 3.741e-18
Identity = 40/82 (48.78%), Postives = 50/82 (60.98%), Query Frame = 2
Query:   11 CPTCRQELGDIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHK 256
            CPTCR  LG IR LA+EKVA S+  PCKY   GC    P+  K +HE +C FRPY+CP  G+ C   G +  ++ HL   HK
Sbjct:   72 CPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEVTLPHTDKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLLHQHK 153          
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SIA1A_MOUSE (E3 ubiquitin-protein ligase SIAH1A OS=Mus musculus GN=Siah1a PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 3.741e-18
Identity = 40/82 (48.78%), Postives = 50/82 (60.98%), Query Frame = 2
Query:   11 CPTCRQELGDIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHK 256
            CPTCR  LG IR LA+EKVA S+  PCKY   GC    P+  K +HE +C FRPY+CP  G+ C   G +  ++ HL   HK
Sbjct:   72 CPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHK 153          
BLAST of FK826629 vs. ExPASy Swiss-Prot
Match: SIAH1_HUMAN (E3 ubiquitin-protein ligase SIAH1 OS=Homo sapiens GN=SIAH1 PE=1 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 6.381e-18
Identity = 40/82 (48.78%), Postives = 49/82 (59.76%), Query Frame = 2
Query:   11 CPTCRQELGDIRCLALEKVAESLELPCKYYHLGCPELFPYYSKLKHEVMCTFRPYNCPYAGSDCSVVGDIPYLVAHLRDDHK 256
            CPTCR  LG IR LA+EKVA S+  PCKY   GC    P+  K  HE +C FRPY+CP  G+ C   G +  ++ HL   HK
Sbjct:   72 CPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHK 153          
The following BLAST results are available for this feature:
BLAST of FK826629 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
SINA3_ARATH9.403e-6289.57E3 ubiquitin-protein ligase SINAT3 OS=Arabidopsis ... [more]
SINA4_ARATH1.604e-6188.70E3 ubiquitin-protein ligase SINAT4 OS=Arabidopsis ... [more]
SINA5_ARATH2.316e-6088.70E3 ubiquitin-protein ligase SINAT5 OS=Arabidopsis ... [more]
SINA2_ARATH1.454e-5481.58E3 ubiquitin-protein ligase SINAT2 OS=Arabidopsis ... [more]
SINA1_ARATH1.231e-5380.70Putative E3 ubiquitin-protein ligase SINAT1 OS=Ara... [more]
SINA_SCHMA1.984e-1950.00E3 ubiquitin-protein ligase sina OS=Schistosoma ma... [more]
SIAH1_RAT3.741e-1848.78E3 ubiquitin-protein ligase SIAH1 OS=Rattus norveg... [more]
SIAH1_DANRE3.741e-1848.78E3 ubiquitin-protein ligase Siah1 OS=Danio rerio G... [more]
SIA1A_MOUSE3.741e-1848.78E3 ubiquitin-protein ligase SIAH1A OS=Mus musculus... [more]
SIAH1_HUMAN6.381e-1848.78E3 ubiquitin-protein ligase SIAH1 OS=Homo sapiens ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionclone385 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 385, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826629 ID=FK826629|Name=FK826629|organism=Citrus sinensis|type=EST|length=463bp
ACACAACCGGTGCCCCACTTGTAGACAGGAGCTCGGAGATATTAGGTGTT
TAGCATTGGAGAAGGTGGCTGAATCACTTGAACTGCCATGCAAGTATTAC
CACCTGGGTTGCCCAGAGCTATTTCCATATTACAGCAAACTTAAACATGA
GGTTATGTGCACCTTCAGACCGTATAACTGCCCATATGCTGGGTCAGATT
GCTCTGTCGTTGGGGACATCCCATACTTGGTTGCCCATTTGAGGGACGAT
CACAAAGTAGATATGCACACAGGATGCACATTCAATCATCGCTATGTGAA
GTCCAATCCCCGTGAAGTAGAGAATGCTACTTGGATGCTTACAGTAAGTG
TATTTGATTAAAGATTCGTTAATTTGCTCTATACATTTGACGTAAGTGTG
ATGGTTCCTGGAAAATATAGTGTTTTAACATTAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAG
back to top