FE659085

Overview
NameFE659085
Unique NameFE659085
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length340
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8732 contig Csv1_Contig8732:152..491. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FE659085 vs. ExPASy Swiss-Prot
Match: INO1_SESIN (Inositol-3-phosphate synthase OS=Sesamum indicum PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 1.805e-57
Identity = 108/113 (95.58%), Postives = 111/113 (98.23%), Query Frame = 2
Query:    2 PGLIDLAIRRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYGPGEHPDHVVVIKYVPYVGDSKRAMDE 340
            PGLIDLAI+RN LIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMV+SNGILY PGEHPDH+VVIKYVPYVGDSKRAMDE
Sbjct:  289 PGLIDLAIQRNSLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVASNGILYEPGEHPDHIVVIKYVPYVGDSKRAMDE 401          
BLAST of FE659085 vs. ExPASy Swiss-Prot
Match: INO1_TOBAC (Inositol-3-phosphate synthase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 2.357e-57
Identity = 109/113 (96.46%), Postives = 110/113 (97.35%), Query Frame = 2
Query:    2 PGLIDLAIRRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYGPGEHPDHVVVIKYVPYVGDSKRAMDE 340
            PGLIDLAI+RN LIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSN ILY PGEHPDHVVVIKYVPYVGDSKRAMDE
Sbjct:  289 PGLIDLAIKRNTLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNAILYEPGEHPDHVVVIKYVPYVGDSKRAMDE 401          
BLAST of FE659085 vs. ExPASy Swiss-Prot
Match: INO1_MESCR (Inositol-3-phosphate synthase OS=Mesembryanthemum crystallinum PE=2 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 2.357e-57
Identity = 108/113 (95.58%), Postives = 111/113 (98.23%), Query Frame = 2
Query:    2 PGLIDLAIRRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYGPGEHPDHVVVIKYVPYVGDSKRAMDE 340
            PGLIDLAI++N LIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMV+SNGILY PGEHPDHVVVIKYVPYVGDSKRAMDE
Sbjct:  291 PGLIDLAIKKNSLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVASNGILYEPGEHPDHVVVIKYVPYVGDSKRAMDE 403          
BLAST of FE659085 vs. ExPASy Swiss-Prot
Match: INO1_MAIZE (Inositol-3-phosphate synthase OS=Zea mays PE=2 SV=2)

HSP 1 Score: 220.32 bits (560), Expect = 2.357e-57
Identity = 108/113 (95.58%), Postives = 109/113 (96.46%), Query Frame = 2
Query:    2 PGLIDLAIRRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYGPGEHPDHVVVIKYVPYVGDSKRAMDE 340
            PGLIDLAI+ NCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQ FRSKEISKSNVVDDMVSSN ILY PGEHPDHVVVIKYVPYVGDSKRAMDE
Sbjct:  289 PGLIDLAIKNNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQAFRSKEISKSNVVDDMVSSNAILYEPGEHPDHVVVIKYVPYVGDSKRAMDE 401          
BLAST of FE659085 vs. ExPASy Swiss-Prot
Match: INO1_HORVU (Inositol-3-phosphate synthase OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 2.357e-57
Identity = 108/113 (95.58%), Postives = 110/113 (97.35%), Query Frame = 2
Query:    2 PGLIDLAIRRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYGPGEHPDHVVVIKYVPYVGDSKRAMDE 340
            PGLIDLAI+ +CLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSN ILY PGEHPDHVVVIKYVPYVGDSKRAMDE
Sbjct:  289 PGLIDLAIKNDCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNAILYEPGEHPDHVVVIKYVPYVGDSKRAMDE 401          
BLAST of FE659085 vs. ExPASy Swiss-Prot
Match: INO3_ARATH (Probable inositol-3-phosphate synthase isozyme 3 OS=Arabidopsis thaliana GN=At5g10170 PE=2 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 3.079e-57
Identity = 108/113 (95.58%), Postives = 110/113 (97.35%), Query Frame = 2
Query:    2 PGLIDLAIRRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYGPGEHPDHVVVIKYVPYVGDSKRAMDE 340
            PGLI+LAI+RNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMV SNGILY PGEHPDHVVVIKYVP VGDSKRAMDE
Sbjct:  289 PGLIELAIKRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVGSNGILYEPGEHPDHVVVIKYVPCVGDSKRAMDE 401          
BLAST of FE659085 vs. ExPASy Swiss-Prot
Match: INO1_WHEAT (Inositol-3-phosphate synthase OS=Triticum aestivum GN=MIPS PE=2 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 3.079e-57
Identity = 107/113 (94.69%), Postives = 111/113 (98.23%), Query Frame = 2
Query:    2 PGLIDLAIRRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYGPGEHPDHVVVIKYVPYVGDSKRAMDE 340
            PGLI+LAI +NCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMV+SNGIL+ PGEHPDHVVVIKYVPYVGDSKRAMDE
Sbjct:  289 PGLIELAISKNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVASNGILFEPGEHPDHVVVIKYVPYVGDSKRAMDE 401          
BLAST of FE659085 vs. ExPASy Swiss-Prot
Match: INO1_SPIPO (Inositol-3-phosphate synthase OS=Spirodela polyrrhiza GN=TUR1 PE=2 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 3.079e-57
Identity = 107/113 (94.69%), Postives = 111/113 (98.23%), Query Frame = 2
Query:    2 PGLIDLAIRRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYGPGEHPDHVVVIKYVPYVGDSKRAMDE 340
            PGLI++AI+RN LIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILY PGEHPDHV+VIKYVPYVGDSKRAMDE
Sbjct:  289 PGLIEMAIKRNSLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYEPGEHPDHVIVIKYVPYVGDSKRAMDE 401          
BLAST of FE659085 vs. ExPASy Swiss-Prot
Match: INO1_NICPA (Inositol-3-phosphate synthase OS=Nicotiana paniculata GN=INPS1 PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 5.252e-57
Identity = 108/113 (95.58%), Postives = 110/113 (97.35%), Query Frame = 2
Query:    2 PGLIDLAIRRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYGPGEHPDHVVVIKYVPYVGDSKRAMDE 340
            PGLIDLAI++N LIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSN ILY PGEHPDHVVVIKYVPYVGDSKRAMDE
Sbjct:  289 PGLIDLAIKKNTLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNAILYEPGEHPDHVVVIKYVPYVGDSKRAMDE 401          
BLAST of FE659085 vs. ExPASy Swiss-Prot
Match: INO1_ORYSJ (Inositol-3-phosphate synthase OS=Oryza sativa subsp. japonica GN=INO1 PE=2 SV=2)

HSP 1 Score: 218.394 bits (555), Expect = 8.958e-57
Identity = 108/113 (95.58%), Postives = 109/113 (96.46%), Query Frame = 2
Query:    2 PGLIDLAIRRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYGPGEHPDHVVVIKYVPYVGDSKRAMDE 340
            PGLIDLAI+ NCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSN ILY  GEHPDHVVVIKYVPYVGDSKRAMDE
Sbjct:  289 PGLIDLAIKNNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNAILYELGEHPDHVVVIKYVPYVGDSKRAMDE 401          
The following BLAST results are available for this feature:
BLAST of FE659085 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
INO1_SESIN1.805e-5795.58Inositol-3-phosphate synthase OS=Sesamum indicum P... [more]
INO1_TOBAC2.357e-5796.46Inositol-3-phosphate synthase OS=Nicotiana tabacum... [more]
INO1_MESCR2.357e-5795.58Inositol-3-phosphate synthase OS=Mesembryanthemum ... [more]
INO1_MAIZE2.357e-5795.58Inositol-3-phosphate synthase OS=Zea mays PE=2 SV=... [more]
INO1_HORVU2.357e-5795.58Inositol-3-phosphate synthase OS=Hordeum vulgare P... [more]
INO3_ARATH3.079e-5795.58Probable inositol-3-phosphate synthase isozyme 3 O... [more]
INO1_WHEAT3.079e-5794.69Inositol-3-phosphate synthase OS=Triticum aestivum... [more]
INO1_SPIPO3.079e-5794.69Inositol-3-phosphate synthase OS=Spirodela polyrrh... [more]
INO1_NICPA5.252e-5795.58Inositol-3-phosphate synthase OS=Nicotiana panicul... [more]
INO1_ORYSJ8.958e-5795.58Inositol-3-phosphate synthase OS=Oryza sativa subs... [more]

Pages

back to top
Libraries
Library NameType
Hong Anliu sweet orange SSH librarycdna_library
Properties
Property NameValue
Genbank descriptionC24 Hong Anliu sweet orange SSH library Citrus sinensis cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FE659085 ID=FE659085|Name=FE659085|organism=Citrus sinensis|type=EST|length=340bp
ACCAGGGCTTATTGACTTGGCTATTAGGAGGAACTGTTTGATTGGTGGAG
ATGACTTCAAGAGTGGGCAGACTAAGATGAAATCTGTTTTGGTTGATTTC
CTTGTTGGGGCAGGAATCAAGCCAACATCAATTGTTAGCTACAACCACCT
GGGAAACAATGATGGAATGAATCTTTCAGCCCCTCAAACCTTCCGCTCCA
AGGAGATTTCCAAAAGTAATGTTGTTGATGACATGGTCTCCAGCAATGGT
ATCCTTTATGGGCCTGGTGAACACCCCGACCACGTTGTGGTCATCAAGTA
TGTGCCATATGTTGGCGATAGCAAGAGAGCCATGGATGAG
back to top