FE659076
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of FE659076 vs. ExPASy Swiss-Prot
Match: TRXH_RICCO (Thioredoxin H-type OS=Ricinus communis PE=3 SV=1) HSP 1 Score: 97.4413 bits (241), Expect = 2.323e-20 Identity = 45/63 (71.43%), Postives = 55/63 (87.30%), Query Frame = -3 Query: 115 LSELAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 303 L+ELAKKLP V FLKVDVDELK+VA EWAVE+MPTF+ KEGK+++++VGAKKDELQ + KH Sbjct: 50 LAELAKKLPNVTFLKVDVDELKTVAHEWAVESMPTFMFLKEGKIMDKVVGAKKDELQQTIAKH 112
BLAST of FE659076 vs. ExPASy Swiss-Prot
Match: TRXH2_TOBAC (Thioredoxin H-type 2 OS=Nicotiana tabacum PE=3 SV=1) HSP 1 Score: 96.2857 bits (238), Expect = 5.176e-20 Identity = 44/62 (70.97%), Postives = 54/62 (87.10%), Query Frame = -3 Query: 115 SELAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 300 +ELAKK+P V FLKVDVDELKSVA +WAVEAMPTF+ KEGK+++++VGAKKDELQ + KH Sbjct: 50 AELAKKMPTVTFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKH 111
BLAST of FE659076 vs. ExPASy Swiss-Prot
Match: TRXH1_ARATH (Thioredoxin H-type 1 OS=Arabidopsis thaliana GN=TRX1 PE=1 SV=1) HSP 1 Score: 94.7449 bits (234), Expect = 1.506e-19 Identity = 42/62 (67.74%), Postives = 54/62 (87.10%), Query Frame = -3 Query: 115 SELAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 300 ++LAKKLP V+FLKVD DELKSVA +WA++AMPTF+ KEGK+L+++VGAKKDELQ + KH Sbjct: 51 ADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKH 112
BLAST of FE659076 vs. ExPASy Swiss-Prot
Match: TRXH1_TOBAC (Thioredoxin H-type 1 OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 92.0485 bits (227), Expect = 9.761e-19 Identity = 42/63 (66.67%), Postives = 55/63 (87.30%), Query Frame = -3 Query: 115 LSELAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 303 L+++AKK+P VIFLKVDVDELK+V+ EW+VEAMPTFV K+GK ++R+VGAKK+ELQ + KH Sbjct: 56 LADIAKKMPHVIFLKVDVDELKTVSAEWSVEAMPTFVFIKDGKEVDRVVGAKKEELQQTIVKH 118
BLAST of FE659076 vs. ExPASy Swiss-Prot
Match: TRXH_PICMA (Thioredoxin H-type OS=Picea mariana GN=SB09 PE=2 SV=1) HSP 1 Score: 82.4185 bits (202), Expect = 7.734e-16 Identity = 36/58 (62.07%), Postives = 48/58 (82.76%), Query Frame = -3 Query: 124 ELAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAV 297 EL+KK P + FLKVDVDEL+ VA+EW VEAMPTF+ K+GK ++++VGAKKD+L+ V Sbjct: 50 ELSKKFPEIFFLKVDVDELRDVAQEWDVEAMPTFIFIKDGKAVDKVVGAKKDDLERKV 107
BLAST of FE659076 vs. ExPASy Swiss-Prot
Match: TRXH_FAGES (Thioredoxin H-type OS=Fagopyrum esculentum PE=3 SV=1) HSP 1 Score: 82.4185 bits (202), Expect = 7.734e-16 Identity = 41/63 (65.08%), Postives = 50/63 (79.37%), Query Frame = -3 Query: 115 LSELAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 303 +SELAKK P V F KVDVD+LK VAEE+ VEAMP+FV+ KEG+ +ERIVGA+KDEL + H Sbjct: 49 VSELAKKFPHVAFFKVDVDDLKDVAEEYKVEAMPSFVILKEGQEVERIVGARKDELLHKIAVH 111
BLAST of FE659076 vs. ExPASy Swiss-Prot
Match: TRXH_WHEAT (Thioredoxin H-type OS=Triticum aestivum PE=1 SV=3) HSP 1 Score: 79.337 bits (194), Expect = 6.547e-15 Identity = 38/62 (61.29%), Postives = 49/62 (79.03%), Query Frame = -3 Query: 115 SELAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 300 ++LAKK PA +FLKVDVDELK +AE+++VEAMPTF+ KEG V +R+VGA K+EL V H Sbjct: 63 ADLAKKFPAAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTTKVGLH 124
BLAST of FE659076 vs. ExPASy Swiss-Prot
Match: TRXH_ORYSJ (Thioredoxin H-type OS=Oryza sativa subsp. japonica GN=TRXH PE=1 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 8.551e-15 Identity = 36/62 (58.06%), Postives = 48/62 (77.42%), Query Frame = -3 Query: 115 SELAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 300 +E AKK P +FLKVDVDELK VAE++ VEAMPTF+ K+G +++VGA+KD+LQ + KH Sbjct: 51 AEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKH 112
BLAST of FE659076 vs. ExPASy Swiss-Prot
Match: TRXH_ORYSI (Thioredoxin H-type OS=Oryza sativa subsp. indica GN=TRXH PE=1 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 8.551e-15 Identity = 36/62 (58.06%), Postives = 48/62 (77.42%), Query Frame = -3 Query: 115 SELAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 300 +E AKK P +FLKVDVDELK VAE++ VEAMPTF+ K+G +++VGA+KD+LQ + KH Sbjct: 51 AEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKH 112
BLAST of FE659076 vs. ExPASy Swiss-Prot
Match: TRXH5_ARATH (Thioredoxin H-type 5 OS=Arabidopsis thaliana GN=TRX5 PE=2 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 1.459e-14 Identity = 35/62 (56.45%), Postives = 49/62 (79.03%), Query Frame = -3 Query: 115 SELAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 300 +E+AKK V+F K+DVDEL++VA+E+ VEAMPTFV KEG +++R+VGA KDE+ + KH Sbjct: 50 AEMAKKFTNVVFFKIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKH 111 The following BLAST results are available for this feature:
BLAST of FE659076 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 17
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FE659076 ID=FE659076; Name=FE659076; organism=Citrus sinensis; type=EST; length=305bpback to top |