EY692343

Overview
NameEY692343
Unique NameEY692343
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length615
Libraries
Library NameType
Sweet orange bark, greenhouse plantcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY692343 vs. ExPASy Swiss-Prot
Match: INO1_SESIN (Inositol-3-phosphate synthase OS=Sesamum indicum PE=2 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 1.026e-48
Identity = 98/104 (94.23%), Postives = 101/104 (97.12%), Query Frame = 3
Query:   15 FLGV*STIVLHNTCEDSLLAAPIILNLVLLAELSTRIQLKAEGEGKFHSFHPVATILIYLTKAPLVPPGTPMVNALSKQRAMLENILRACVGLAPENNMILEYK 326
            F+G  STIVLHNTCEDSLLAAPIIL+LVLLAELSTRIQLKAEGEGKFHSFHPVATIL YLTKAPLVPPGTP+VNALSKQRAMLENILRACVGLAPENNMILEYK
Sbjct:  407 FMGGKSTIVLHNTCEDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510          
BLAST of EY692343 vs. ExPASy Swiss-Prot
Match: INO1_CITPA (Inositol-3-phosphate synthase OS=Citrus paradisi PE=3 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 1.026e-48
Identity = 98/104 (94.23%), Postives = 101/104 (97.12%), Query Frame = 3
Query:   15 FLGV*STIVLHNTCEDSLLAAPIILNLVLLAELSTRIQLKAEGEGKFHSFHPVATILIYLTKAPLVPPGTPMVNALSKQRAMLENILRACVGLAPENNMILEYK 326
            F+G  STIVLHNTCEDSLLAAPIIL+LVLLAELSTRIQLKAEGEGKFHSFHPVATIL YLTKAPLVPPGTP+VNALSKQRAMLENILRACVGLAPENNMILEYK
Sbjct:  404 FMGGKSTIVLHNTCEDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 507          
BLAST of EY692343 vs. ExPASy Swiss-Prot
Match: INO1_TOBAC (Inositol-3-phosphate synthase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 2.286e-48
Identity = 97/104 (93.27%), Postives = 101/104 (97.12%), Query Frame = 3
Query:   15 FLGV*STIVLHNTCEDSLLAAPIILNLVLLAELSTRIQLKAEGEGKFHSFHPVATILIYLTKAPLVPPGTPMVNALSKQRAMLENILRACVGLAPENNMILEYK 326
            F+G  +TIVLHNTCEDSLLAAPIIL+LVLLAELSTRIQLKAEGEGKFHSFHPVATIL YLTKAPLVPPGTP+VNALSKQRAMLENILRACVGLAPENNMILEYK
Sbjct:  407 FMGGKNTIVLHNTCEDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510          
BLAST of EY692343 vs. ExPASy Swiss-Prot
Match: INO1_NICPA (Inositol-3-phosphate synthase OS=Nicotiana paniculata GN=INPS1 PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 2.286e-48
Identity = 97/104 (93.27%), Postives = 101/104 (97.12%), Query Frame = 3
Query:   15 FLGV*STIVLHNTCEDSLLAAPIILNLVLLAELSTRIQLKAEGEGKFHSFHPVATILIYLTKAPLVPPGTPMVNALSKQRAMLENILRACVGLAPENNMILEYK 326
            F+G  +TIVLHNTCEDSLLAAPIIL+LVLLAELSTRIQLKAEGEGKFHSFHPVATIL YLTKAPLVPPGTP+VNALSKQRAMLENILRACVGLAPENNMILEYK
Sbjct:  407 FMGGKNTIVLHNTCEDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510          
BLAST of EY692343 vs. ExPASy Swiss-Prot
Match: INO2_ARATH (Inositol-3-phosphate synthase isozyme 2 OS=Arabidopsis thaliana GN=At2g22240 PE=2 SV=2)

HSP 1 Score: 189.504 bits (480), Expect = 1.135e-47
Identity = 95/104 (91.35%), Postives = 100/104 (96.15%), Query Frame = 3
Query:   15 FLGV*STIVLHNTCEDSLLAAPIILNLVLLAELSTRIQLKAEGEGKFHSFHPVATILIYLTKAPLVPPGTPMVNALSKQRAMLENILRACVGLAPENNMILEYK 326
            F+G  +TIVLHNTCEDSLLAAPIIL+LVLLAELSTRIQ KAEGEGKFHSFHPVATIL YLTKAPLVPPGTP+VNALSKQRAMLENILRACVGLAPENNMI+EYK
Sbjct:  407 FMGGRNTIVLHNTCEDSLLAAPIILDLVLLAELSTRIQFKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMIMEYK 510          
BLAST of EY692343 vs. ExPASy Swiss-Prot
Match: INO1_ORYSJ (Inositol-3-phosphate synthase OS=Oryza sativa subsp. japonica GN=INO1 PE=2 SV=2)

HSP 1 Score: 187.963 bits (476), Expect = 3.301e-47
Identity = 95/104 (91.35%), Postives = 100/104 (96.15%), Query Frame = 3
Query:   15 FLGV*STIVLHNTCEDSLLAAPIILNLVLLAELSTRIQLKAEGEGKFHSFHPVATILIYLTKAPLVPPGTPMVNALSKQRAMLENILRACVGLAPENNMILEYK 326
            F+G  STIVLHNTCEDSLLAAPIIL+LVLLAELSTRIQLKAEGE KFHSFHPVATIL YLTKAPLVPPGTP+VNAL+KQRAMLENI+RACVGLAPENNMILEYK
Sbjct:  407 FMGGKSTIVLHNTCEDSLLAAPIILDLVLLAELSTRIQLKAEGEEKFHSFHPVATILSYLTKAPLVPPGTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 510          
BLAST of EY692343 vs. ExPASy Swiss-Prot
Match: INO1_SPIPO (Inositol-3-phosphate synthase OS=Spirodela polyrrhiza GN=TUR1 PE=2 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 5.631e-47
Identity = 94/104 (90.38%), Postives = 100/104 (96.15%), Query Frame = 3
Query:   15 FLGV*STIVLHNTCEDSLLAAPIILNLVLLAELSTRIQLKAEGEGKFHSFHPVATILIYLTKAPLVPPGTPMVNALSKQRAMLENILRACVGLAPENNMILEYK 326
            F+G  STI+LHNTCEDSLLAAPIIL+LVLLAELSTRIQLKAEGE KFHSFHPVA+IL YL+KAPLVPPGTP+VNALSKQRAMLENILRACVGLAPENNMILEYK
Sbjct:  407 FMGGKSTIILHNTCEDSLLAAPIILDLVLLAELSTRIQLKAEGESKFHSFHPVASILSYLSKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510          
BLAST of EY692343 vs. ExPASy Swiss-Prot
Match: INO1_MAIZE (Inositol-3-phosphate synthase OS=Zea mays PE=2 SV=2)

HSP 1 Score: 187.193 bits (474), Expect = 5.631e-47
Identity = 94/104 (90.38%), Postives = 100/104 (96.15%), Query Frame = 3
Query:   15 FLGV*STIVLHNTCEDSLLAAPIILNLVLLAELSTRIQLKAEGEGKFHSFHPVATILIYLTKAPLVPPGTPMVNALSKQRAMLENILRACVGLAPENNMILEYK 326
            F+G  +TIVLHNTCEDSLLAAPIIL+LVLLAELSTRIQLKAEGE KFHSFHPVATIL YLTKAPLVPPGTP+VNAL+KQRAMLENI+RACVGLAPENNMILEYK
Sbjct:  407 FMGGKNTIVLHNTCEDSLLAAPIILDLVLLAELSTRIQLKAEGEDKFHSFHPVATILSYLTKAPLVPPGTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 510          
BLAST of EY692343 vs. ExPASy Swiss-Prot
Match: INO1_WHEAT (Inositol-3-phosphate synthase OS=Triticum aestivum GN=MIPS PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 9.605e-47
Identity = 94/104 (90.38%), Postives = 99/104 (95.19%), Query Frame = 3
Query:   15 FLGV*STIVLHNTCEDSLLAAPIILNLVLLAELSTRIQLKAEGEGKFHSFHPVATILIYLTKAPLVPPGTPMVNALSKQRAMLENILRACVGLAPENNMILEYK 326
            F+G  +TIV+HNTCEDSLLAAPIIL+LVLLAELSTRIQ KAEGEGKFHSFHPVATIL YLTKAPLVP GTP+VNALSKQRAMLENILRACVGLAPENNMILEYK
Sbjct:  407 FMGGKNTIVMHNTCEDSLLAAPIILDLVLLAELSTRIQFKAEGEGKFHSFHPVATILSYLTKAPLVPAGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510          
BLAST of EY692343 vs. ExPASy Swiss-Prot
Match: INO1_MESCR (Inositol-3-phosphate synthase OS=Mesembryanthemum crystallinum PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.140e-46
Identity = 94/104 (90.38%), Postives = 99/104 (95.19%), Query Frame = 3
Query:   15 FLGV*STIVLHNTCEDSLLAAPIILNLVLLAELSTRIQLKAEGEGKFHSFHPVATILIYLTKAPLVPPGTPMVNALSKQRAMLENILRACVGLAPENNMILEYK 326
            F+G  +TIV+HNTCEDSLLAAPIIL+LVLLAELSTRIQLKAE E KFHSFHPVATIL YLTKAPLVPPGTP+VNALSKQRAMLENILRACVGLAPENNMILEYK
Sbjct:  409 FMGGTNTIVMHNTCEDSLLAAPIILDLVLLAELSTRIQLKAEEEDKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 512          
The following BLAST results are available for this feature:
BLAST of EY692343 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
INO1_SESIN1.026e-4894.23Inositol-3-phosphate synthase OS=Sesamum indicum P... [more]
INO1_CITPA1.026e-4894.23Inositol-3-phosphate synthase OS=Citrus paradisi P... [more]
INO1_TOBAC2.286e-4893.27Inositol-3-phosphate synthase OS=Nicotiana tabacum... [more]
INO1_NICPA2.286e-4893.27Inositol-3-phosphate synthase OS=Nicotiana panicul... [more]
INO2_ARATH1.135e-4791.35Inositol-3-phosphate synthase isozyme 2 OS=Arabido... [more]
INO1_ORYSJ3.301e-4791.35Inositol-3-phosphate synthase OS=Oryza sativa subs... [more]
INO1_SPIPO5.631e-4790.38Inositol-3-phosphate synthase OS=Spirodela polyrrh... [more]
INO1_MAIZE5.631e-4790.38Inositol-3-phosphate synthase OS=Zea mays PE=2 SV=... [more]
INO1_WHEAT9.605e-4790.38Inositol-3-phosphate synthase OS=Triticum aestivum... [more]
INO1_MESCR2.140e-4690.38Inositol-3-phosphate synthase OS=Mesembryanthemum ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C2-003-059-D06-CT.F Sweet orange bark, greenhouse plant Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY692343 ID=EY692343; Name=EY692343; organism=Citrus sinensis; type=EST; length=615bp
CGGACGCGTGGGATTTCTTGGGCGTTTAGAGCACCATTGTGCTGCACAAC
ACGTGTGAGGACTCTCTTTTGGCTGCTCCAATCATTCTAAATTTGGTTCT
GCTGGCTGAACTCAGCACCAGGATCCAGCTCAAAGCTGAAGGAGAGGGAA
AATTCCACTCTTTCCACCCTGTGGCTACAATTCTCATCTACCTCACCAAG
GCTCCTCTGGTCCCTCCGGGCACACCAATGGTGAATGCGCTGTCAAAGCA
GCGTGCAATGCTTGAGAACATTCTGAGGGCTTGCGTTGGCTTGGCTCCTG
AGAACAACATGATTTTGGAATACAAGTGAAGAACTTGCAGGGGAGAAAAG
TGGAAGAACCGGTATTCCCTTTCTCTGGCACCAATCGAAGCTGTGGTGGT
CCATTTAATTACTGATTGTAATGTCTTGTGTCATGAGATTGTGGTTAATA
TTAGTGTCCTGTATGTTTGCTCTTTTATTTTTTTAATGAAGGTGCTGGAG
TGTAGCCCATTGCCTTTGTAGCTCATTTCGGAGCATGCAATCTCTTGTAT
TGCAAGTAAATAATATATGGAAGTTCAAAAATAACTGTATTGCGGCAAAA
AAAAAAAAAAAAGGG
back to top