EY692341

Overview
NameEY692341
Unique NameEY692341
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length992
Libraries
Library NameType
Sweet orange bark, greenhouse plantcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY692341 vs. ExPASy Swiss-Prot
Match: CCT15_ARATH (Cyclin-T1-5 OS=Arabidopsis thaliana GN=CYCT1-5 PE=2 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 1.798e-16
Identity = 55/120 (45.83%), Postives = 72/120 (60.00%), Query Frame = 2
Query:    2 EKMKREHRQSWSKSHENSDHGKGHGEVGDGNHLGTKGHSSRGLEAENAEEGEMVDG--SPMLNSRKRKAGSPVDRQSEGKKQHDYMSSYNHDNIEDGHKMSRPS--YSDREYRRHAQENH 349
            EK K    QS  K+  +   G  HGE+     L  KG      E +N EEGEMV+   SPM++SRKRK GSP ++QSEGK++H      N +N E+ HK SR S  + DRE+RRH+QEN+
Sbjct:  475 EKTKERKVQSRPKAENSDLMGTEHGEI-----LDVKG------EVKNTEEGEMVNNNVSPMMHSRKRKMGSPPEKQSEGKRRH------NSENGEESHKTSRGSSHHGDREHRRHSQENN 577          
BLAST of EY692341 vs. ExPASy Swiss-Prot
Match: CCT14_ARATH (Cyclin-T1-4 OS=Arabidopsis thaliana GN=CYCT1-4 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.970e-11
Identity = 46/103 (44.66%), Postives = 58/103 (56.31%), Query Frame = 2
Query:   53 SDHGKGHGEVGDGNHLGTKGHSSRGLEAENAEEGEMVDG-SPMLNSRKRKAGSPVDRQ-SEGKKQHDYMSSYNHDNIEDGHKM----SRPSYSDREYRRHAQE 343
            S  G  HGE+ DGN+L             N EEGEM+D  S  + SRKRK  SP ++Q  EGK++HD     N +N+E+G K     S  SY DRE RRH+QE
Sbjct:  454 SSMGTEHGEILDGNNL-----------VVNTEEGEMIDDVSSTMPSRKRKMESPCEKQLGEGKRRHD-----NSENVEEGQKTNPGGSSHSYGDREPRRHSQE 540          
The following BLAST results are available for this feature:
BLAST of EY692341 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
CCT15_ARATH1.798e-1645.83Cyclin-T1-5 OS=Arabidopsis thaliana GN=CYCT1-5 PE=... [more]
CCT14_ARATH2.970e-1144.66Cyclin-T1-4 OS=Arabidopsis thaliana GN=CYCT1-4 PE=... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C2-003-059-D04-CT.F Sweet orange bark, greenhouse plant Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY692341 ID=EY692341; Name=EY692341; organism=Citrus sinensis; type=EST; length=992bp
TGAGAAAATGAAGCGGGAGCACAGGCAAAGCTGGTCAAAATCACATGAGA
ATTCCGATCATGGTAAGGGCCACGGGGAAGTTGGAGATGGGAATCACTTG
GGCACAAAAGGACACTCGTCAAGGGGATTGGAAGCTGAGAATGCTGAAGA
AGGGGAAATGGTTGATGGTTCCCCCATGTTGAACAGTCGAAAGAGAAAGG
CTGGGAGCCCGGTGGATAGGCAGTCAGAAGGAAAGAAGCAGCACGATTAC
ATGTCAAGTTACAACCATGATAACATAGAAGATGGACACAAGATGAGTCG
GCCTAGCTATAGTGATAGGGAGTACAGAAGGCATGCACAAGAGAACCATT
TGTGAGGGAAAATGATACCTGTAGTTGGTTTGTTCGCTATATTATTTGGT
CACGGATGACTGACCATTGGTATGAACTTCTGGACACTGATTATTTAAAC
TGGCCGGTCTCAGCTTTGGATGCTCAAACCGTTGACGATTGTATCGCAAT
TAGGTTGATTTTGCATTGCCTGTAATGGCTCATAATGGCTCATATCTTTA
TTGTAAAACATTGTTGAGGAATGAGGATGGCTTCAATCTGCGTAATCATT
AAATGAAAATAGCCCTGAAAAATGAGGGGATTTTCTTTCNGAGAGGTAGA
ATGATATCAAATAGTTAAAATATAGATCAATCAAATAAAACATGATGGGG
TGGGCCGCTTTATAGGATCCAATCTTTATTTACGCTGGGCATGGAGCTGT
ACAAACCTCTTGCAGTAGGGGCACCTGTAAGTTAATTTTCACGGGCGCGA
CCGTTTGATAAGGGTCGGGTAAGGGGGATAAACCTTGGGCTGGATCACCG
CAATTTTACTCCACTGGGGAGAACGTACCCCCCCTTTCTACCAAAGTGAC
TGTTGACTGTTGCGAAAAGATAGGCCATATCAGAGATTCCATCTATCATC
GAATATAGTGTAAAGAATTAATACAAGGGGAATGCGAAATAA
back to top