EY692336

Overview
NameEY692336
Unique NameEY692336
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length996
Libraries
Library NameType
Sweet orange bark, greenhouse plantcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY692336 vs. ExPASy Swiss-Prot
Match: BH110_ARATH (Transcription factor bHLH110 OS=Arabidopsis thaliana GN=BHLH110 PE=2 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 1.930e-18
Identity = 79/232 (34.05%), Postives = 111/232 (47.84%), Query Frame = 3
Query:   78 AISSGFPINGNHFPAGDLYSSAHNISSVGGAMPSRGNFSQIYPXXXXXXXXXXXXXXXXX-------FDMNLQFLD--LLASSRFSGDFSQPSHDNLGLYKESLP-FGCD-QHHLXXXXXXXXXXXXNKIAHFINNSEITEATKRHGGVMEPKATQFASKKSRLESRASCPPMKVRKKKLGDKICS----SSAFG*RPSARQIPHPYYWRLLGTSSSFQTRSRL*LVPYMKS 728
            ++SSGFPING++     L SS+   SS   +   RGNFSQIYP                        FD+N+Q  D  L   +     F+     +LG+ + SLP FG    HHL            +++  F N  + +E  KRH  +M  KA + ASKK R+ESR+SCPP KVRK+KLGD+I +     S FG   +A  +        +G     Q++     VPYM++
Sbjct:  164 SMSSGFPINGDY--GSSLPSSSS--SSSPSSQSHRGNFSQIYPSVNISSLSESRKMSMDDMSNISRPFDINMQVFDGRLFEGNVLVPPFNAQEISSLGMSRGSLPSFGLPFHHHLQQTLPHLSSSPTHQMEMFSNEPQTSEG-KRHNFLMATKAGENASKKPRVESRSSCPPFKVRKEKLGDRIAALQQLVSPFGKTDTASVL-----MEAIGYIKFLQSQIETLSVPYMRA 385          
The following BLAST results are available for this feature:
BLAST of EY692336 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
BH110_ARATH1.930e-1834.05Transcription factor bHLH110 OS=Arabidopsis thalia... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C2-003-059-C09-CT.F Sweet orange bark, greenhouse plant Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY692336 ID=EY692336; Name=EY692336; organism=Citrus sinensis; type=EST; length=996bp
CGGACGCGTGGGCAAGCTACTTAAAGAATGAGCAGAAGAATTTGAATGAT
CTCGGTGACAAGCTATTGCTCAAGAGTGCTATCTCTTCAGGATTTCCAAT
CAATGGGAATCATTTTCCAGCTGGAGATTTGTATTCAAGTGCCCACAACA
TTTCAAGTGTTGGAGGTGCTATGCCCAGTAGAGGAAACTTCAGCCAGATT
TATCCGAGTATAAATATTTCAAACTTGAGTCAAACATCTTCTACAAATTC
AACCAACTTTGACATGAACTTGCAGTTTTTGGATCTGTTAGCATCGTCAA
GATTTAGTGGTGATTTTAGCCAGCCTTCACATGACAATCTTGGTTTATAT
AAAGAGAGCCTTCCTTTCGGTTGTGATCAGCATCATTTACAGCAATCAAG
TCGCCGGCCATCTTGTAGTCCTAGCAATAAAATAGCACACTTCATCAATA
ACAGTGAAATAACAGAGGCAACAAAGCGACACGGCGGTGTGATGGAGCCA
AAGGCAACGCAGTTTGCGTCTAAGAAATCGAGATTGGAGTCACGCGCTTC
TTGCCCTCCTATGAAAGTTAGGAAAAAGAAACTAGGAGATAAAATTTGCA
GCTCTTCAGCATTTGGGTAGCGCCCTTCGGCAAGACAGATACCGCATCCG
TACTACTGGAGGCTATTGGGTACATCAAGTTCCTTTCAAACCAGGTCAAG
ACTTTAATTGGTCCCTTACATGAAATCCATCACGGGAACAAAGCCTCCAA
AAAAAATGGAGGGGGGTTCAAATTGGAACAAAAGGGGAATGAAAAACCCA
AACCAAATTTTAAAAAAATCCCAAGGCCTTTGGCTTTGGAAATTTATCCA
GGCCTGGCCATAACTTTCACAAAGGACCCCTGGGGGGGGGGGGAAATTGG
GCCCCCCCCCTGAAACTTTGCGGGGGGAGGCAAATTAAAATTTTATTATT
TTTTGATCAGTCTTTTCCCTCCTATTACACCTTATGTGGGCGAAAA
back to top