EY692335

Overview
NameEY692335
Unique NameEY692335
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length980
Libraries
Library NameType
Sweet orange bark, greenhouse plantcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY692335 vs. ExPASy Swiss-Prot
Match: H33_VITVI (Histone H3.3 OS=Vitis vinifera PE=2 SV=3)

HSP 1 Score: 248.054 bits (632), Expect = 5.979e-65
Identity = 126/126 (100.00%), Postives = 126/126 (100.00%), Query Frame = 1
Query:   34 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ 411
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ 126          
BLAST of EY692335 vs. ExPASy Swiss-Prot
Match: H33_TOBAC (Histone H3.3 OS=Nicotiana tabacum GN=H3 PE=1 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 5.979e-65
Identity = 126/126 (100.00%), Postives = 126/126 (100.00%), Query Frame = 1
Query:   34 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ 411
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ 126          
BLAST of EY692335 vs. ExPASy Swiss-Prot
Match: H33_PINPS (Histone H3.3 OS=Pinus pinaster PE=2 SV=3)

HSP 1 Score: 248.054 bits (632), Expect = 5.979e-65
Identity = 126/126 (100.00%), Postives = 126/126 (100.00%), Query Frame = 1
Query:   34 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ 411
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ 126          
BLAST of EY692335 vs. ExPASy Swiss-Prot
Match: H33_ORYSJ (Histone H3.3 OS=Oryza sativa subsp. japonica GN=H3 PE=2 SV=2)

HSP 1 Score: 248.054 bits (632), Expect = 5.979e-65
Identity = 126/126 (100.00%), Postives = 126/126 (100.00%), Query Frame = 1
Query:   34 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ 411
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ 126          
BLAST of EY692335 vs. ExPASy Swiss-Prot
Match: H33_ORYSI (Histone H3.3 OS=Oryza sativa subsp. indica GN=OsI_011536 PE=2 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 5.979e-65
Identity = 126/126 (100.00%), Postives = 126/126 (100.00%), Query Frame = 1
Query:   34 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ 411
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ 126          
BLAST of EY692335 vs. ExPASy Swiss-Prot
Match: H33_ORYCO (Histone H3.3 OS=Oryza coarctata PE=2 SV=3)

HSP 1 Score: 248.054 bits (632), Expect = 5.979e-65
Identity = 126/126 (100.00%), Postives = 126/126 (100.00%), Query Frame = 1
Query:   34 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ 411
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ 126          
BLAST of EY692335 vs. ExPASy Swiss-Prot
Match: H33_MEDSA (Histone H3.3 OS=Medicago sativa PE=1 SV=2)

HSP 1 Score: 248.054 bits (632), Expect = 5.979e-65
Identity = 126/126 (100.00%), Postives = 126/126 (100.00%), Query Frame = 1
Query:   34 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ 411
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ 126          
BLAST of EY692335 vs. ExPASy Swiss-Prot
Match: H33_LOLTE (Histone H3.3 OS=Lolium temulentum PE=2 SV=2)

HSP 1 Score: 248.054 bits (632), Expect = 5.979e-65
Identity = 126/126 (100.00%), Postives = 126/126 (100.00%), Query Frame = 1
Query:   34 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ 411
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ 126          
BLAST of EY692335 vs. ExPASy Swiss-Prot
Match: H33_LOLMU (Histone H3.3 OS=Lolium multiflorum GN=RH3 PE=2 SV=3)

HSP 1 Score: 248.054 bits (632), Expect = 5.979e-65
Identity = 126/126 (100.00%), Postives = 126/126 (100.00%), Query Frame = 1
Query:   34 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ 411
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ 126          
BLAST of EY692335 vs. ExPASy Swiss-Prot
Match: H33_GOSHI (Histone H3.3 OS=Gossypium hirsutum GN=HIS3 PE=2 SV=3)

HSP 1 Score: 248.054 bits (632), Expect = 5.979e-65
Identity = 126/126 (100.00%), Postives = 126/126 (100.00%), Query Frame = 1
Query:   34 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ 411
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ 126          
The following BLAST results are available for this feature:
BLAST of EY692335 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 211
Match NameE-valueIdentityDescription
H33_VITVI5.979e-65100.00Histone H3.3 OS=Vitis vinifera PE=2 SV=3[more]
H33_TOBAC5.979e-65100.00Histone H3.3 OS=Nicotiana tabacum GN=H3 PE=1 SV=1[more]
H33_PINPS5.979e-65100.00Histone H3.3 OS=Pinus pinaster PE=2 SV=3[more]
H33_ORYSJ5.979e-65100.00Histone H3.3 OS=Oryza sativa subsp. japonica GN=H3... [more]
H33_ORYSI5.979e-65100.00Histone H3.3 OS=Oryza sativa subsp. indica GN=OsI_... [more]
H33_ORYCO5.979e-65100.00Histone H3.3 OS=Oryza coarctata PE=2 SV=3[more]
H33_MEDSA5.979e-65100.00Histone H3.3 OS=Medicago sativa PE=1 SV=2[more]
H33_LOLTE5.979e-65100.00Histone H3.3 OS=Lolium temulentum PE=2 SV=2[more]
H33_LOLMU5.979e-65100.00Histone H3.3 OS=Lolium multiflorum GN=RH3 PE=2 SV=... [more]
H33_GOSHI5.979e-65100.00Histone H3.3 OS=Gossypium hirsutum GN=HIS3 PE=2 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C2-003-059-C05-CT.F Sweet orange bark, greenhouse plant Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY692335 ID=EY692335; Name=EY692335; organism=Citrus sinensis; type=EST; length=980bp
GAAATTGAGTGGAAGAGTTGAAGATACTCAGAGATGGCCCGTACCAAGCA
AACTGCACGTAAGTCAACCGGAGGAAAGGCTCCTAGGAAGCAACTTGCTA
CCAAGGCCGCCCGTAAGTCTGCGCCCACCACCGGTGGTGTTAAGAAGCCT
CATCGTTACCGTCCTGGAACCGTCGCCCTTCGAGAAATTCGCAAGTACCA
GAAGAGTACCGAGCTGCTTATCAGGAAACTCCCATTCCAGAGACTTGTTC
GTGAAATTGCTCAGGACTTTAAGACTGATCTGCGTTTCCAGAGCCATGCA
GTACTGGCCCTGCAGGAGGCAGCGGAGGCTTACCTTGTTGGTCTCTTCGA
GGACACTAACCTCTGCGCCATTCATGCAAAGCGTGTCACTATTATGCCCA
AGGACATACAGCTTGCCCGTAGGATCCGTGGCGAGCGTGCTTAAGCGTAA
TTGCTGCTTGCTTCAATTGAATGACTGGAAGGGAAGGGGGAAGTTGTAAT
GTGTTAATTTGTACGTGGGGGTTGGTGGGGGTAGATAGGGGTAAGATTCC
GGTAGTTATAAAAATATGGGCTTTTGGCATCCTCATCGGGTTTTGTTTTT
GGTGGCGAATAATCAAGATAATCAGGAGAATAAGGGAATCTTAATTGCTG
CTAAAAAATAATGCGAGTAGGGACCCTTCGCGACACCTAAGGCCCAGACA
AGGTAAAATGGAACTTCTATTATAATATACTACAGTATTGGCATTAGTAT
ATTTATAAAAATAAAGAAAAATAATATTAAAAAGTATGGAGTAAGCTAAA
GAACAAATAATACACAAGAAGAATAAACGCAGATGAGACAAGAATATTTT
AACTATAAAATAACGTTCAACAATCCAACAAAACAAAAAAATTAATAACA
TACACTAAAATTTTTTAAATAATAAGAAGAAAGTGATAAATTGTGGAGAG
TGCATTCATGATGTGTAGGTGAATGTACTT
back to top