EY692334

Overview
NameEY692334
Unique NameEY692334
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length523
Libraries
Library NameType
Sweet orange bark, greenhouse plantcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY692334 vs. ExPASy Swiss-Prot
Match: PPD1_ARATH (PsbP domain-containing protein 1, chloroplastic OS=Arabidopsis thaliana GN=PPD1 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 5.912e-23
Identity = 43/61 (70.49%), Postives = 52/61 (85.25%), Query Frame = 2
Query:   71 ELAVMPKDPVLDLEWDRRYLSVLGVENNRLDDVTLQTPENVFVEEENDLRQVIDSFRVNKV 253
            ELAVMP+D V  LEW+RRYL+VLGVEN+RL  + LQTPE VF+EEE DLR+V+DSFRV K+
Sbjct:  227 ELAVMPQDRVARLEWNRRYLAVLGVENDRLYSIRLQTPEKVFLEEEKDLRRVMDSFRVEKI 287          

HSP 2 Score: 39.2762 bits (90), Expect = 5.912e-23
Identity = 17/22 (77.27%), Postives = 21/22 (95.45%), Query Frame = 1
Query:    1 RVADDGRLYYLVEVNIKSFAHH 66
            RVADDG+LYY VEVNIKS+A++
Sbjct:  204 RVADDGKLYYQVEVNIKSYANN 225          
The following BLAST results are available for this feature:
BLAST of EY692334 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
PPD1_ARATH5.912e-2370.49PsbP domain-containing protein 1, chloroplastic OS... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C2-003-059-C04-CT.F Sweet orange bark, greenhouse plant Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY692334 ID=EY692334; Name=EY692334; organism=Citrus sinensis; type=EST; length=523bp
CGGGTTGCTGATGATGGCAGGCTCTATTACCTAGTCGAGGTGAACATAAA
GTCATTTGCACACCACAAGTGAGCTAGCTGTGATGCCCAAGGATCCAGTA
CTTGATTTGGAATGGGACCGGCGGTATCTTTCAGTTCTTGGAGTTGAAAA
CAACCGGTTGGATGATGTGACATTACAGACGCCAGAAAATGTATTTGTAG
AAGAAGAGAATGATCTTAGGCAAGTTATAGACTCCTTCAGAGTAAATAAG
GTTTCCGCTTGATCATTTCGGATAGCAGCAGAAATTCTGCTCCTTTTGGT
GACCCAAGGCTCTTTGGTCGTTTCAGCAATAATTTGTAATACAATCCCCG
GCAACACAGATGGGTTTTGCATTGTTTTGCGGATATATCAAGATAATCGT
GCAATGAGTTTATCCCTTTTGTCCGTGTGGAGTGTACATCCCCTAATGAA
AAGTCATTAATTTGTTCAAGCTTTACAAAGCAGTGCTGAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAA
back to top