EY692331

Overview
NameEY692331
Unique NameEY692331
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length982
Libraries
Library NameType
Sweet orange bark, greenhouse plantcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY692331 vs. ExPASy Swiss-Prot
Match: RL3_ORYSJ (60S ribosomal protein L3 OS=Oryza sativa subsp. japonica GN=RPL3 PE=2 SV=2)

HSP 1 Score: 296.975 bits (759), Expect = 4.698e-81
Identity = 139/148 (93.92%), Postives = 143/148 (96.62%), Query Frame = 3
Query:   27 KGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKVYKLGKGGQESHTGITEFDRTEKDITPMGGFPHYGIVKDDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKIKFIDTSSKFGHG 470
            KGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTEMNKKVYK+GK GQESH   TEFDRTEKDITPMGGFPHYG+VK DYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIK+KFIDTSSKFGHG
Sbjct:  225 KGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYKIGKSGQESHAACTEFDRTEKDITPMGGFPHYGVVKGDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHG 372          

HSP 2 Score: 26.9498 bits (58), Expect = 4.698e-81
Identity = 9/20 (45.00%), Postives = 16/20 (80.00%), Query Frame = 1
Query:  463 GMARFQTTQEKLKYYGRMES 522
            G  RFQTT EK +++G++++
Sbjct:  370 GHGRFQTTDEKQRFFGKLKA 389          
BLAST of EY692331 vs. ExPASy Swiss-Prot
Match: RL32_ARATH (60S ribosomal protein L3-2 OS=Arabidopsis thaliana GN=ARP2 PE=2 SV=4)

HSP 1 Score: 284.263 bits (726), Expect = 3.602e-78
Identity = 131/148 (88.51%), Postives = 143/148 (96.62%), Query Frame = 3
Query:   27 KGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKVYKLGKGGQESHTGITEFDRTEKDITPMGGFPHYGIVKDDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKIKFIDTSSKFGHG 470
            KGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTEMNKKVY++GK GQE+H+ +TE+DRTEKDITPMGGFPHYGIVK+DYLMIKGCCVGPKKRVVTLRQ+LLKQTSRLA+EEIK+KFID +S  GHG
Sbjct:  225 KGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYRVGKVGQETHSAMTEYDRTEKDITPMGGFPHYGIVKEDYLMIKGCCVGPKKRVVTLRQTLLKQTSRLAMEEIKLKFIDAASNGGHG 372          

HSP 2 Score: 30.0314 bits (66), Expect = 3.602e-78
Identity = 12/17 (70.59%), Postives = 14/17 (82.35%), Query Frame = 1
Query:  463 GMARFQTTQEKLKYYGR 513
            G  RFQT+QEK K+YGR
Sbjct:  370 GHGRFQTSQEKAKFYGR 386          
BLAST of EY692331 vs. ExPASy Swiss-Prot
Match: RL31_ARATH (60S ribosomal protein L3-1 OS=Arabidopsis thaliana GN=ARP1 PE=2 SV=5)

HSP 1 Score: 288.115 bits (736), Expect = 6.127e-78
Identity = 133/148 (89.86%), Postives = 143/148 (96.62%), Query Frame = 3
Query:   27 KGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKVYKLGKGGQESHTGITEFDRTEKDITPMGGFPHYGIVKDDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKIKFIDTSSKFGHG 470
            KGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTE+NKK+Y+LGK G E+HT +TE+DRTEKD+TPMGGFPHYGIVKDDYLMIKGCCVGPKKRVVTLRQSLL QTSRLALEEIK+KFIDT+S FGHG
Sbjct:  225 KGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTELNKKIYRLGKVGTEAHTAMTEYDRTEKDVTPMGGFPHYGIVKDDYLMIKGCCVGPKKRVVTLRQSLLTQTSRLALEEIKLKFIDTASIFGHG 372          

HSP 2 Score: 25.409 bits (54), Expect = 6.127e-78
Identity = 9/18 (50.00%), Postives = 14/18 (77.78%), Query Frame = 1
Query:  463 GMARFQTTQEKLKYYGRM 516
            G  RFQT+ EK+++Y R+
Sbjct:  370 GHGRFQTSLEKMRFYNRV 387          
BLAST of EY692331 vs. ExPASy Swiss-Prot
Match: RL3_DROME (60S ribosomal protein L3 OS=Drosophila melanogaster GN=RpL3 PE=1 SV=3)

HSP 1 Score: 225.328 bits (573), Expect = 4.150e-58
Identity = 103/154 (66.88%), Postives = 125/154 (81.17%), Query Frame = 3
Query:   27 KGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKVYKLGKGGQES------HTGITEFDRTEKDITPMGGFPHYGIVKDDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKIKFIDTSSKFGHG 470
            KGKG++GV +RW   +LPRKTH+GLRKVACIGAWHP+RVS TVARAGQ GYHHRTE+NKK+Y++G G          +   TE+D T+K ITPMGGFPHYG V +D++MIKGCC+G KKR++TLR+SLLK T R ALE+IK+KFIDTSSK GHG
Sbjct:  224 KGKGFKGVTSRWHTKKLPRKTHKGLRKVACIGAWHPSRVSTTVARAGQKGYHHRTEINKKIYRIGAGIHTKDGKVIKNNASTEYDLTDKSITPMGGFPHYGEVNNDFVMIKGCCIGSKKRIITLRKSLLKHTKRSALEQIKLKFIDTSSKMGHG 377          
BLAST of EY692331 vs. ExPASy Swiss-Prot
Match: RL3_TOXCA (60S ribosomal protein L3 OS=Toxocara canis GN=RPL3 PE=2 SV=2)

HSP 1 Score: 221.476 bits (563), Expect = 5.993e-57
Identity = 100/151 (66.23%), Postives = 123/151 (81.46%), Query Frame = 3
Query:   27 KGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKVYKLGKG---GQESHTGITEFDRTEKDITPMGGFPHYGIVKDDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKIKFIDTSSKFGHG 470
            KGKG++GV +RW   +LPRKTH+GLRKVACIGAWHP+RV FTVARAGQ GYHHRTE+NKK+Y+LGK     +    G T++D TEK + PMGGFPHYG+V  D++MI+GCCVG KKR +TLR+SL+ QT R A E+I +K+IDTSSKFGHG
Sbjct:  224 KGKGFKGVTSRWHTKKLPRKTHKGLRKVACIGAWHPSRVQFTVARAGQKGYHHRTEVNKKIYRLGKSCLTEEGKKNGGTDYDITEKSVNPMGGFPHYGLVNQDFVMIRGCCVGSKKRPITLRKSLIVQTKRFAHEKINLKWIDTSSKFGHG 374          
BLAST of EY692331 vs. ExPASy Swiss-Prot
Match: RL3_DICDI (60S ribosomal protein L3 OS=Dictyostelium discoideum GN=rpl3 PE=1 SV=2)

HSP 1 Score: 221.476 bits (563), Expect = 5.993e-57
Identity = 102/152 (67.11%), Postives = 123/152 (80.92%), Query Frame = 3
Query:   27 KGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKVYKLGKG----GQESHTGITEFDRTEKDITPMGGFPHYGIVKDDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKIKFIDTSSKFGHG 470
            KGKG+ GV+ RWGV +LPRKTH+GLRKVACIGAWHP+RVS TV RAGQ GYHHR E NKK+Y++G+     G++  TG TEFD TEK I PMGGF HYG+VK ++LM+KGC  GP+KR +TLR+S+  QT R ALE+I +KFIDTSSKFGHG
Sbjct:  225 KGKGFNGVIKRWGVRKLPRKTHKGLRKVACIGAWHPSRVSTTVPRAGQLGYHHRVERNKKIYRIGQAQPEDGKQISTGKTEFDLTEKTINPMGGFAHYGMVKHEFLMLKGCVAGPRKRALTLRKSITTQTGRAALEKITLKFIDTSSKFGHG 376          
BLAST of EY692331 vs. ExPASy Swiss-Prot
Match: RL3_ASHGO (60S ribosomal protein L3 OS=Ashbya gossypii GN=RPL3 PE=3 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 8.654e-56
Identity = 102/148 (68.92%), Postives = 120/148 (81.08%), Query Frame = 3
Query:   27 KGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKVYKLGKGGQESHTGITEFDRTEKDITPMGGFPHYGIVKDDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKIKFIDTSSKFGHG 470
            KG G+EGV  RWG  +LPRKTHRGLRKVACIGAWHPA V +TVARAGQNGYHHRT +N KVY++GKGG E +   TEFDRT+K ITPMGGF HYG V +D++M+KG   G +KRVVTLR+SL   TSR ALEE+ +K+IDT+SKFG G
Sbjct:  223 KGHGFEGVTHRWGTKKLPRKTHRGLRKVACIGAWHPAHVMWTVARAGQNGYHHRTSINHKVYRIGKGGDEGNAA-TEFDRTKKTITPMGGFVHYGAVNNDFVMVKGSIPGTRKRVVTLRKSLYTSTSRRALEEVNLKWIDTASKFGKG 369          
BLAST of EY692331 vs. ExPASy Swiss-Prot
Match: RL3_MOUSE (60S ribosomal protein L3 OS=Mus musculus GN=Rpl3 PE=2 SV=2)

HSP 1 Score: 216.083 bits (549), Expect = 2.518e-55
Identity = 101/154 (65.58%), Postives = 124/154 (80.52%), Query Frame = 3
Query:   27 KGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKVYKLGK------GGQESHTGITEFDRTEKDITPMGGFPHYGIVKDDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKIKFIDTSSKFGHG 470
            KGKGY+GV +RW   +LPRKTHRGLRKVACIGAWHPARV+FTVARAGQ GYHHRTE+NKK+YK+G+      G    +   T++D ++K I P+GGF HYG V +D++M+KGC VG KKRV+TLR+SLL QT R ALE+I +KFIDT+SKFGHG
Sbjct:  224 KGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFTVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFIMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHG 377          
BLAST of EY692331 vs. ExPASy Swiss-Prot
Match: RL3_RAT (60S ribosomal protein L3 OS=Rattus norvegicus GN=Rpl3 PE=1 SV=3)

HSP 1 Score: 214.542 bits (545), Expect = 7.326e-55
Identity = 100/154 (64.94%), Postives = 124/154 (80.52%), Query Frame = 3
Query:   27 KGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKVYKLGK------GGQESHTGITEFDRTEKDITPMGGFPHYGIVKDDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKIKFIDTSSKFGHG 470
            KGKGY+GV +RW   +LPRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKK+YK+G+      G    +   T++D ++K I P+GGF HYG V +D++M+KGC VG KKRV+TLR+SLL QT R ALE+I +KFIDT+SKFGHG
Sbjct:  224 KGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFIMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHG 377          
BLAST of EY692331 vs. ExPASy Swiss-Prot
Match: RL3_HUMAN (60S ribosomal protein L3 OS=Homo sapiens GN=RPL3 PE=1 SV=2)

HSP 1 Score: 214.157 bits (544), Expect = 9.568e-55
Identity = 100/154 (64.94%), Postives = 124/154 (80.52%), Query Frame = 3
Query:   27 KGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKVYKLGK------GGQESHTGITEFDRTEKDITPMGGFPHYGIVKDDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKIKFIDTSSKFGHG 470
            KGKGY+GV +RW   +LPRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKK+YK+G+      G    +   T++D ++K I P+GGF HYG V +D++M+KGC VG KKRV+TLR+SLL QT R ALE+I +KFIDT+SKFGHG
Sbjct:  224 KGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHG 377          
The following BLAST results are available for this feature:
BLAST of EY692331 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 84
Match NameE-valueIdentityDescription
RL3_ORYSJ4.698e-8193.9260S ribosomal protein L3 OS=Oryza sativa subsp. ja... [more]
RL32_ARATH3.602e-7888.5160S ribosomal protein L3-2 OS=Arabidopsis thaliana... [more]
RL31_ARATH6.127e-7889.8660S ribosomal protein L3-1 OS=Arabidopsis thaliana... [more]
RL3_DROME4.150e-5866.8860S ribosomal protein L3 OS=Drosophila melanogaste... [more]
RL3_TOXCA5.993e-5766.2360S ribosomal protein L3 OS=Toxocara canis GN=RPL3... [more]
RL3_DICDI5.993e-5767.1160S ribosomal protein L3 OS=Dictyostelium discoide... [more]
RL3_ASHGO8.654e-5668.9260S ribosomal protein L3 OS=Ashbya gossypii GN=RPL... [more]
RL3_MOUSE2.518e-5565.5860S ribosomal protein L3 OS=Mus musculus GN=Rpl3 P... [more]
RL3_RAT7.326e-5564.9460S ribosomal protein L3 OS=Rattus norvegicus GN=R... [more]
RL3_HUMAN9.568e-5564.9460S ribosomal protein L3 OS=Homo sapiens GN=RPL3 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C2-003-059-B12-CT.F Sweet orange bark, greenhouse plant Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY692331 ID=EY692331; Name=EY692331; organism=Citrus sinensis; type=EST; length=982bp
GATGATTGACATCATCGGCGCCTTTTAAAGGTAAAGGTTATGAAGGTGTT
GTCACCCGTTGGGGTGTTACCCGCCTTCCTCGCAAGACTCACAGAGGTCT
GCGTAAGGTGGCTTGTATTGGTGCCTGGCATCCTGCTAGGGTTTCCTTCA
CAGTTGCCAGAGCTGGTCAGAATGGATACCATCATCGTACTGAAATGAAC
AAGAAGGTTTACAAGCTTGGCAAGGGTGGACAGGAGTCTCACACTGGCAT
AACTGAATTTGACAGGACTGAGAAGGACATTACCCCAATGGGTGGCTTTC
CTCACTATGGTATTGTGAAAGATGATTATTTGATGATCAAGGGATGCTGT
GTTGGACCTAAGAAGAGGGTGGTCACGCTTCGTCAGTCGCTTCTCAAACA
GACATCTCGTTTAGCTCTTGAGGAAATCAAAATCAAGTTCATTGATACCT
CTTCCAAGTTTGGGCATGGCCCGCTTCCAGACTACACAGGAGAAACTGAA
GTACTATGGACGCATGGAAAGCTAATTATGCTAAAAAGAACAGAGTTTTT
GCCCCGTTATAGTTAATTTCAGGCAGTCAAAATTTTTTCCAGTTAGAATA
TCTTGGAACAGTTTTTTAAGCCTGGCATTCAGCTGTGTTTCTTTTTCCTT
TTCTTAATTCTATTTTTAACAAAAAGGGCGTTGCTTTATTTCATTGGAAA
ATTTTCTTATCTTAAAAATATTCCCCAACCCCCAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAGGGCCAGGCAGTCTTTAGAGGAATCATCTTTATAATAA
ATCATGGAATGATACCATAAAAGTTCTTTCACTTATAGCACCCACCAATT
TGCTATTCTATGGACGATAACATACGTAAAGACTTCTAGAAAACAAGGAA
AAAAGATAGGTTGCTTTACACACATTATAATTAGATTGCAATGAGAACTA
AATACTCATCACGATTTTTATCGAGATGATTG
back to top