EY692327

Overview
NameEY692327
Unique NameEY692327
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length987
Libraries
Library NameType
Sweet orange bark, greenhouse plantcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY692327 vs. ExPASy Swiss-Prot
Match: IAA8_ARATH (Auxin-responsive protein IAA8 OS=Arabidopsis thaliana GN=IAA8 PE=2 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 4.200e-66
Identity = 117/161 (72.67%), Postives = 141/161 (87.58%), Query Frame = 1
Query:   37 SAPAAKAQVV*WPPIRSFRKNTMASNLVKNNDAAEGKSGSGCLYVKVSMDGAPYLRKVDLKIYSNYMELSSALEKMFSCFTIGQCDSHGLPGQDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFTETCRRLRIMKGSEAIGLAPRAMEKCKNR 519
            +APAAKAQVV WPPIRS+RKNTMAS+  KN D  +GK G G L+VKVSMDGAPYLRKVDL+ Y++Y +LSSALEKMFSCFT+GQC  HG  G++ +SE +L DLLHGSE+VLTYEDKDGDWMLVGDVPW++FTETC++L+IMKGS++IGLAP A+EK KN+
Sbjct:  158 NAPAAKAQVVGWPPIRSYRKNTMASSTSKNTDEVDGKPGLGVLFVKVSMDGAPYLRKVDLRTYTSYQQLSSALEKMFSCFTLGQCGLHGAQGRERMSEIKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGLAPGAVEKSKNK 318          
BLAST of EY692327 vs. ExPASy Swiss-Prot
Match: IAA27_ARATH (Auxin-responsive protein IAA27 OS=Arabidopsis thaliana GN=IAA27 PE=2 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 1.265e-62
Identity = 124/179 (69.27%), Postives = 143/179 (79.89%), Query Frame = 1
Query:    7 VPALNAH*PTSAPAAKAQVV*WPPIRSFRKNTMASNLVK---NN---DAAEGKSG--SGCLYVKVSMDGAPYLRKVDLKIYSNYMELSSALEKMFSCFTIGQCDSHGLPGQDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFTETCRRLRIMKGSEAIGLAPRAMEKCKNR 519
            VP        +APA+KAQVV WPPIRSFRKN+MAS+  +   NN   + AE KSG    CLYVKVSM+GAPYLRK+DLK Y +Y+ELSSALEKMFSCFTIGQ  SHG  G+DGL+ESRL DLL GSEYV+TYEDKD DWMLVGDVPW+MF  +C++LRIMK SEAIGLAPR MEKC++R
Sbjct:  126 VPVKEKKSSATAPASKAQVVGWPPIRSFRKNSMASSQSQKPGNNSETEEAEAKSGPEQPCLYVKVSMEGAPYLRKIDLKTYKSYLELSSALEKMFSCFTIGQFGSHGGCGRDGLNESRLTDLLRGSEYVVTYEDKDSDWMLVGDVPWEMFICSCKKLRIMKSSEAIGLAPRVMEKCRSR 304          
BLAST of EY692327 vs. ExPASy Swiss-Prot
Match: IAA21_ORYSJ (Auxin-responsive protein IAA21 OS=Oryza sativa subsp. japonica GN=IAA21 PE=2 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 1.652e-62
Identity = 120/164 (73.17%), Postives = 136/164 (82.93%), Query Frame = 1
Query:   40 APAAKAQVV*WPPIRSFRKNTMASN--LVKNNDAAEGKSG--SGCLYVKVSMDGAPYLRKVDLKIYSNYMELSSALEKMFSCFTIGQCDSHGLPGQDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFTETCRRLRIMKGSEAIGLAPRAMEKCKNR 519
            APAAKAQVV WPPIRS+RKNTMA +   +K  D  E K    SGCLYVKVSMDGAPYLRKVDLK+Y NY ELS ALEKMFSCFT+G  +S+G  G+DGLS+ RLMDL +G+E VLTYEDKD DWMLVGDVPW MFT++CRRLRIMKGS+A+GLAPRA +K KNR
Sbjct:  102 APAAKAQVVGWPPIRSYRKNTMAMSQPALKGKDDGEAKQAPASGCLYVKVSMDGAPYLRKVDLKMYKNYKELSLALEKMFSCFTVGHGESNGKSGRDGLSDCRLMDLKNGTELVLTYEDKDEDWMLVGDVPWRMFTDSCRRLRIMKGSDAVGLAPRATDKSKNR 265          
BLAST of EY692327 vs. ExPASy Swiss-Prot
Match: IAA30_ORYSJ (Auxin-responsive protein IAA30 OS=Oryza sativa subsp. japonica GN=IAA30 PE=2 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 3.115e-61
Identity = 118/170 (69.41%), Postives = 138/170 (81.18%), Query Frame = 1
Query:   31 PTSAPAAKAQVV*WPPIRSFRKNTMASNLVKNNDAAEG---KSGSGCL---YVKVSMDGAPYLRKVDLKIYSNYMELSSALEKMFSCFTIGQCDSHGLPGQDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFTETCRRLRIMKGSEAIGLAPRAMEKCKNRT 522
            P    A KAQVV WPP+RS+RKN +A    K  DAA+G   KSG+G     +VKVSMDGAPYLRKVDLK+Y +Y+ELS ALEKMFS FTIG C SHG+   +G++ES++ DLL+GSEYV TYEDKDGDWMLVGDVPW+MF E+C+RLRIMKGSEAIGLAPRAMEKCKNR+
Sbjct:  111 PEKPRAPKAQVVGWPPVRSYRKNILAVQADKGKDAADGGGDKSGAGAAAAAFVKVSMDGAPYLRKVDLKMYKSYLELSKALEKMFSSFTIGNCGSHGV---NGMNESKIADLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 277          
BLAST of EY692327 vs. ExPASy Swiss-Prot
Match: IAA9_ARATH (Auxin-responsive protein IAA9 OS=Arabidopsis thaliana GN=IAA9 PE=1 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 6.939e-61
Identity = 113/164 (68.90%), Postives = 139/164 (84.76%), Query Frame = 1
Query:   34 TSAPAAKAQVV*WPPIRSFRKNTMASNLVKNNDAAEGKSGSGCLYVKVSMDGAPYLRKVDLKIYSNYMELSSALEKMFSCFTIGQCDSHGLPGQDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFTETCRRLRIMKGSEAIGL--APRAMEKCKNR 519
            +S PAAKAQ+V WPP+RS+RKNT+A+   KN+D  +G+ GSG L+VKVSMDGAPYLRKVDL+ Y+NY ELSSALEKMF+ FT+GQC S+G  G+D LSE++L DLL+G +YVLTYEDKDGDWMLVGDVPW+MF + C++L+IMKG +AIGL  APRAMEK K R
Sbjct:  175 SSPPAAKAQIVGWPPVRSYRKNTLATTC-KNSDEVDGRPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGAAGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGLAAAPRAMEKSKMR 337          
BLAST of EY692327 vs. ExPASy Swiss-Prot
Match: IAA16_ARATH (Auxin-responsive protein IAA16 OS=Arabidopsis thaliana GN=IAA16 PE=2 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 1.146e-55
Identity = 109/174 (62.64%), Postives = 130/174 (74.71%), Query Frame = 1
Query:   43 PAAKAQVV*WPPIRSFRKNTMASNLVKNNDAAEGK-----------SGSGCL---YVKVSMDGAPYLRKVDLKIYSNYMELSSALEKMFSCFTIGQCDSHGLPGQDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFTETCRRLRIMKGSEAIGLAPRAMEKCKNRT 522
            P AKAQVV WPP+RSFRKN M+       DA EG            S S C    YVKVSMDGAPYLRK+DLK+Y  Y +LS+AL KMFS FTIG     G+  +D ++ES+L+DLL+GS+YV TYEDKDGDWMLVGDVPW+MF ++C+R+RIMKGSEAIGLAPRA+EKCKNR+
Sbjct:   65 PPAKAQVVGWPPVRSFRKNVMSGQKPTTGDATEGNDKTSGSSGATSSASACATVAYVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGM--KDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 236          
BLAST of EY692327 vs. ExPASy Swiss-Prot
Match: IAA17_ORYSJ (Auxin-responsive protein IAA17 OS=Oryza sativa subsp. japonica GN=IAA17 PE=2 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 3.336e-55
Identity = 113/161 (70.19%), Postives = 127/161 (78.88%), Query Frame = 1
Query:   40 APAAKAQVV*WPPIRSFRKNTMASNLVKNN-DAAEGKSGSGCLYVKVSMDGAPYLRKVDLKIYSNYMELSSALEKMFSCFTIGQCDSHGLPGQDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFTETCRRLRIMKGSEAIGLAPRAMEKCKNR 519
            APAAKAQVV WPPIRS+RKNTMA+N +K++ + AE K G G LYVKVSMDGAPYLRKVDLK Y NY +LS+ALEKMF  FT G+         DGLSESR        EYVLTYEDKDGDWMLVGDVPW+MF  +CRRLRIMKGS+AIGLAPRA++K KNR
Sbjct:  110 APAAKAQVVGWPPIRSYRKNTMATNQLKSSKEDAEAKQGQGFLYVKVSMDGAPYLRKVDLKTYKNYKDLSTALEKMFIGFTTGK---------DGLSESR-----KDGEYVLTYEDKDGDWMLVGDVPWEMFANSCRRLRIMKGSDAIGLAPRAVDKSKNR 256          
BLAST of EY692327 vs. ExPASy Swiss-Prot
Match: IAA14_ARATH (Auxin-responsive protein IAA14 OS=Arabidopsis thaliana GN=IAA14 PE=1 SV=2)

HSP 1 Score: 209.534 bits (532), Expect = 2.391e-53
Identity = 104/162 (64.20%), Postives = 126/162 (77.78%), Query Frame = 1
Query:   37 SAPAAKAQVV*WPPIRSFRKNTMASNLVKNNDAAEGKSGSGCLYVKVSMDGAPYLRKVDLKIYSNYMELSSALEKMFSCFTIGQCDSHGLPGQDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFTETCRRLRIMKGSEAIGLAPRAMEKCKNRT 522
            S P AKAQVV WPP+R++RKN MA+      + A    G    +VKVSMDGAPYLRKVDLK+Y++Y +LS AL KMFS FT+G   + G+   D ++ES++MDLL+ SEYV +YEDKDGDWMLVGDVPW MF E+C+RLRIMKGSEAIGLAPRAMEK KNR+
Sbjct:   69 SKPPAKAQVVGWPPVRNYRKNVMANQKSGEAEEAMSSGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMI--DFMNESKVMDLLNSSEYVPSYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKFKNRS 228          
BLAST of EY692327 vs. ExPASy Swiss-Prot
Match: IAA19_ORYSJ (Auxin-responsive protein IAA19 OS=Oryza sativa subsp. japonica GN=IAA19 PE=2 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 5.326e-53
Identity = 98/154 (63.64%), Postives = 120/154 (77.92%), Query Frame = 1
Query:   46 AAKAQVV*WPPIRSFRKNTMASNLVKNNDAAEGKSGSGCLYVKVSMDGAPYLRKVDLKIYSNYMELSSALEKMFSCFTIGQCDSHGLPGQDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFTETCRRLRIMKGSEAIGLAPRAMEK 507
            AAKAQVV WPP+RS+RKNT+A++  K     +GKS  GC YVKVSMDGAPYLRKVDLK YS+Y +LS ALEKMFSCF  G+  SH    +D L++    D L   EYVLTYEDKD DWMLVGD+PWD+FT +CR+LRIM+GS+A G+APR++E+
Sbjct:  123 AAKAQVVGWPPVRSYRKNTLAASATKTKGEDQGKSEVGCCYVKVSMDGAPYLRKVDLKTYSSYEDLSLALEKMFSCFITGRSSSHKTSKRDRLTDGSRADALKDQEYVLTYEDKDADWMLVGDLPWDLFTTSCRKLRIMRGSDAAGMAPRSLEQ 276          
BLAST of EY692327 vs. ExPASy Swiss-Prot
Match: AUX28_SOYBN (Auxin-induced protein AUX28 OS=Glycine max GN=AUX28 PE=2 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 3.452e-52
Identity = 104/162 (64.20%), Postives = 124/162 (76.54%), Query Frame = 1
Query:   43 PAAKAQVV*WPPIRSFRKNTMASNLVKNNDAAEGKSGSGCLYVKVSMDGAPYLRKVDLKIYSNYMELSSALEKMFSCFTIGQCDSHGLPGQDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFTETCRRLRIMKGSEAI--GLAPRAMEKCKNRT 522
            P AK QVV WPP+RSFRKN +A       ++ E  S     +VKVSMDGAPYLRKVDLK+Y +Y ELS +L KMFS FT G C+S G+  +D ++ES+L DLL+ S+YV TYEDKDGDWMLVGDVPW+MF E+C+RLRIMKG EAI  GLAPRAM KCKNR+
Sbjct:   85 PPAKTQVVGWPPVRSFRKNMLAVQKSVGEES-EKNSSPNASFVKVSMDGAPYLRKVDLKMYKSYRELSDSLGKMFSSFTFGNCESQGM--KDFMNESKLNDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKCKNRS 243          
The following BLAST results are available for this feature:
BLAST of EY692327 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 67
Match NameE-valueIdentityDescription
IAA8_ARATH4.200e-6672.67Auxin-responsive protein IAA8 OS=Arabidopsis thali... [more]
IAA27_ARATH1.265e-6269.27Auxin-responsive protein IAA27 OS=Arabidopsis thal... [more]
IAA21_ORYSJ1.652e-6273.17Auxin-responsive protein IAA21 OS=Oryza sativa sub... [more]
IAA30_ORYSJ3.115e-6169.41Auxin-responsive protein IAA30 OS=Oryza sativa sub... [more]
IAA9_ARATH6.939e-6168.90Auxin-responsive protein IAA9 OS=Arabidopsis thali... [more]
IAA16_ARATH1.146e-5562.64Auxin-responsive protein IAA16 OS=Arabidopsis thal... [more]
IAA17_ORYSJ3.336e-5570.19Auxin-responsive protein IAA17 OS=Oryza sativa sub... [more]
IAA14_ARATH2.391e-5364.20Auxin-responsive protein IAA14 OS=Arabidopsis thal... [more]
IAA19_ORYSJ5.326e-5363.64Auxin-responsive protein IAA19 OS=Oryza sativa sub... [more]
AUX28_SOYBN3.452e-5264.20Auxin-induced protein AUX28 OS=Glycine max GN=AUX2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C2-003-059-B04-CT.F Sweet orange bark, greenhouse plant Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY692327 ID=EY692327; Name=EY692327; organism=Citrus sinensis; type=EST; length=987bp
AATCAAGTCCCTGCTTTAAATGCCCATTAACCAACTAGTGCCCCTGCTGC
AAAGGCACAGGTGGTGTGATGGCCACCTATTCGATCTTTCCGGAAGAACA
CCATGGCCTCTAATTTGGTAAAGAACAATGATGCCGCTGAAGGCAAGTCG
GGATCTGGATGTCTCTATGTAAAGGTTAGCATGGATGGTGCTCCATATCT
AAGGAAGGTTGATCTCAAAATCTACAGCAATTACATGGAACTCTCTTCAG
CTCTTGAGAAGATGTTCAGCTGCTTTACCATTGGGCAATGTGATTCTCAT
GGTCTTCCGGGGCAAGACGGCCTAAGTGAGAGTCGTCTGATGGATCTTCT
CCATGGTTCTGAATATGTGCTTACATATGAAGACAAGGATGGTGACTGGA
TGCTTGTTGGTGATGTCCCTTGGGATATGTTCACTGAGACGTGTAGAAGA
CTTCGCATCATGAAAGGTTCAGAGGCTATTGGACTGGCTCCAAGGGCCAT
GGAGAAGTGCAAGAACCGAACTTAGTGTCGCAAATATCTTGAAAGACTTA
AAAAGGGAGAAAATTTGTTTTTGTCAGAATCCAAAGACGTGAAAAGATGT
TAGGCATTTTGTTCAAGGACCCTATTATTATATAAATGTTATCAAATATC
ATAAGTTTGCTGTATTTAATTAGTTTAAAAGGGGAAAAACATCCCTCTAG
AAAAAAATAGCCCTGGCAAACATATCCCGTTCCACGTTGGTTTTAGTAAA
TTATTTTTGTTCCCCTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAGGGGGGGCCCCCCTTAAAAGAATCCCAAGCTT
TATCAACCCCCGGGGGATGCCAACCGCCCTAAGCTCTTTCTTATAGGGGG
CCCCCTAAATTTTAAATTTCCCCGGGGGCCCCGCGCGTTTTAAAAAAACA
TCTGCGAGGGGGGGGAAAAAACCCCCCGGGGCGCGTC
back to top