EY692326

Overview
NameEY692326
Unique NameEY692326
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1019
Libraries
Library NameType
Sweet orange bark, greenhouse plantcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY692326 vs. ExPASy Swiss-Prot
Match: VATE_CITUN (V-type proton ATPase subunit E OS=Citrus unshiu GN=VATE PE=2 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 2.505e-91
Identity = 160/183 (87.43%), Postives = 161/183 (87.98%), Query Frame = 1
Query:    1 QMVRFIRPLAEEKADEISVSAE*EFNIEKLQLVEAEKKKIXXXXXXXXXXXXXXXXIEYSMQLNASRIKVLQAQDDLVSNMMEAASKEVLNVSRDHNSYKKLLKGLIVQSLLRLKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHQIYLRPGPGHHNAHGPSCSGGVVGAS 549
            QMVRFIR  AEEKA+EISVSAE EFNIEKLQLVEAEKKKI                IEYSMQLNASRIKVLQAQDDLVSNMMEAASKEVLNVSRDHNSYKKLLKGLIVQSLLRLKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDH IYL PGPGHHNAHGPSCSGGVV AS
Sbjct:   12 QMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYERKEKQVEIRKKIEYSMQLNASRIKVLQAQDDLVSNMMEAASKEVLNVSRDHNSYKKLLKGLIVQSLLRLKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHHIYLPPGPGHHNAHGPSCSGGVVVAS 194          

HSP 2 Score: 55.4546 bits (132), Expect = 2.505e-91
Identity = 27/35 (77.14%), Postives = 31/35 (88.57%), Query Frame = 2
Query:  551 RDGEIVCENTLDARLGVVFR*QLPEIRKRLLRHVA 655
            RDG+IVCENTLDARL VVFR +LPEIRK+L+  VA
Sbjct:  195 RDGKIVCENTLDARLDVVFRKKLPEIRKQLVSQVA 229          
BLAST of EY692326 vs. ExPASy Swiss-Prot
Match: VATE_CITLI (V-type proton ATPase subunit E OS=Citrus limon GN=VATE PE=2 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 1.611e-90
Identity = 159/183 (86.89%), Postives = 160/183 (87.43%), Query Frame = 1
Query:    1 QMVRFIRPLAEEKADEISVSAE*EFNIEKLQLVEAEKKKIXXXXXXXXXXXXXXXXIEYSMQLNASRIKVLQAQDDLVSNMMEAASKEVLNVSRDHNSYKKLLKGLIVQSLLRLKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHQIYLRPGPGHHNAHGPSCSGGVVGAS 549
            QMVRFIR  AEEKA+EISVSAE EFNIEKLQLVEAEKKKI                IEYSMQLNASRIKVLQAQDDLVSNMMEAASKEVLNVSRDHNSYKKLLK LIVQSLLRLKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDH IYL PGPGHHNAHGPSCSGGVV AS
Sbjct:   12 QMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYERKEKQVEIRKKIEYSMQLNASRIKVLQAQDDLVSNMMEAASKEVLNVSRDHNSYKKLLKDLIVQSLLRLKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHHIYLPPGPGHHNAHGPSCSGGVVVAS 194          

HSP 2 Score: 55.4546 bits (132), Expect = 1.611e-90
Identity = 27/35 (77.14%), Postives = 31/35 (88.57%), Query Frame = 2
Query:  551 RDGEIVCENTLDARLGVVFR*QLPEIRKRLLRHVA 655
            RDG+IVCENTLDARL VVFR +LPEIRK+L+  VA
Sbjct:  195 RDGKIVCENTLDARLDVVFRKKLPEIRKQLVSQVA 229          
BLAST of EY692326 vs. ExPASy Swiss-Prot
Match: VATE_GOSHI (V-type proton ATPase subunit E OS=Gossypium hirsutum GN=VATE PE=2 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 4.274e-70
Identity = 134/191 (70.16%), Postives = 148/191 (77.49%), Query Frame = 1
Query:    1 QMVRFIRPLAEEKADEISVSAE*EFNIEKLQLVEAEKKKIXXXXXXXXXXXXXXXXIEYSMQLNASRIKVLQAQDDLVSNMMEAASKEVLNVSRDHNSYKKLLKGLIVQSLLRLKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHQIYLRPGPGHHN--------AHGPSCSGGVVGAS 549
            QMVRFIR  AEEKA+EISVSAE EFNIEKLQLVEAEKKKI                IEYSMQLNASRIKVLQAQDD+V+ M E+ASK+ LNVS DH+ YK+LLK LIVQSL+RLKEP VLLRCRK+D HLVESVL+SAKEEYA K+ VHPPEIIVD  ++L PGP HH+        AHGP CSGGVV AS
Sbjct:   12 QMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYEKKEKQVEIRKKIEYSMQLNASRIKVLQAQDDVVNAMKESASKDFLNVSHDHHVYKRLLKDLIVQSLVRLKEPGVLLRCRKEDLHLVESVLDSAKEEYASKVNVHPPEIIVD-DVHLPPGPSHHHGFFHHHAEAHGPFCSGGVVIAS 201          

HSP 2 Score: 45.4394 bits (106), Expect = 4.274e-70
Identity = 24/35 (68.57%), Postives = 26/35 (74.29%), Query Frame = 2
Query:  551 RDGEIVCENTLDARLGVVFR*QLPEIRKRLLRHVA 655
            RDG+IV ENTLDARL V F  +LPEIRK L   VA
Sbjct:  202 RDGKIVFENTLDARLDVAFNKKLPEIRKWLFGQVA 236          
BLAST of EY692326 vs. ExPASy Swiss-Prot
Match: VATE_SPIOL (V-type proton ATPase subunit E OS=Spinacia oleracea GN=VATE PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 1.919e-67
Identity = 128/183 (69.95%), Postives = 142/183 (77.60%), Query Frame = 1
Query:    1 QMVRFIRPLAEEKADEISVSAE*EFNIEKLQLVEAEKKKIXXXXXXXXXXXXXXXXIEYSMQLNASRIKVLQAQDDLVSNMMEAASKEVLNVSRDHNSYKKLLKGLIVQSLLRLKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHQIYLRPGPGHHNAHGPSCSGGVVGAS 549
            QMVRFIR  AEEKA+EISV+AE EFNIEKLQLVEAEKKKI                IEYSMQLNASRIKVLQAQDDLV++M E A+KE+L VS DH+ YK+LLK L+VQSLLRL+EP VLLRCR+DD HLVE VL SAKEEYA+K +VH PEIIVD  I+L  GP HH  HG  CSGGVV AS
Sbjct:   12 QMVRFIRQEAEEKANEISVAAEEEFNIEKLQLVEAEKKKIRPEYERKEKQVQVRRKIEYSMQLNASRIKVLQAQDDLVNSMKEEAAKELLRVSGDHHHYKRLLKELVVQSLLRLREPGVLLRCREDDVHLVEHVLNSAKEEYAEKAEVHTPEIIVD-SIHLPAGPSHHKEHGLHCSGGVVLAS 193          

HSP 2 Score: 45.0542 bits (105), Expect = 1.919e-67
Identity = 22/30 (73.33%), Postives = 26/30 (86.67%), Query Frame = 2
Query:  551 RDGEIVCENTLDARLGVVFR*QLPEIRKRL 640
            RDG+IV ENTLDARL V FR +LP+IRK+L
Sbjct:  194 RDGKIVFENTLDARLEVAFRKKLPQIRKQL 223          
BLAST of EY692326 vs. ExPASy Swiss-Prot
Match: VATE1_ARATH (V-type proton ATPase subunit E1 OS=Arabidopsis thaliana GN=VHA-E1 PE=1 SV=2)

HSP 1 Score: 219.164 bits (557), Expect = 4.228e-64
Identity = 120/183 (65.57%), Postives = 141/183 (77.05%), Query Frame = 1
Query:    1 QMVRFIRPLAEEKADEISVSAE*EFNIEKLQLVEAEKKKIXXXXXXXXXXXXXXXXIEYSMQLNASRIKVLQAQDDLVSNMMEAASKEVLNVSRDHNSYKKLLKGLIVQSLLRLKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHQIYLRPGPGHHNAHGPSCSGGVVGAS 549
            QMVRFIR  AEEKA+EISVSAE EFNIEKLQLVEAEKKKI                I+YSMQLNASRIKVLQAQDD+V+ M + A+K++LNVSRD  +YK+LLK LIVQ LLRLKEP+VLLRCR++D  LVE+VL+ AKEEYA K +VH PE+ VD +I+L P P  ++ HG  CSGGVV AS
Sbjct:   12 QMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQDYEKKEKQADVRKKIDYSMQLNASRIKVLQAQDDIVNAMKDQAAKDLLNVSRDEYAYKQLLKDLIVQCLLRLKEPSVLLRCREEDLGLVEAVLDDAKEEYAGKAKVHAPEVAVDTKIFLPPPPKSNDPHGLHCSGGVVLAS 194          

HSP 2 Score: 48.1358 bits (113), Expect = 4.228e-64
Identity = 24/34 (70.59%), Postives = 26/34 (76.47%), Query Frame = 2
Query:  551 RDGEIVCENTLDARLGVVFR*QLPEIRKRLLRHV 652
            RDG+IVCENTLDARL V FR +LP IRK L   V
Sbjct:  195 RDGKIVCENTLDARLDVAFRMKLPVIRKSLFGQV 228          
BLAST of EY692326 vs. ExPASy Swiss-Prot
Match: VATE_MESCR (V-type proton ATPase subunit E OS=Mesembryanthemum crystallinum GN=VATE PE=2 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 2.953e-62
Identity = 123/183 (67.21%), Postives = 138/183 (75.41%), Query Frame = 1
Query:    1 QMVRFIRPLAEEKADEISVSAE*EFNIEKLQLVEAEKKKIXXXXXXXXXXXXXXXXIEYSMQLNASRIKVLQAQDDLVSNMMEAASKEVLNVSRDHNSYKKLLKGLIVQSLLRLKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHQIYLRPGPGHHNAHGPSCSGGVVGAS 549
            QMVRF+R  AEEKA+EISVSAE EFNIEKLQLVEAEKKKI                IEYSMQLNASRIKVLQAQDDLV+ M EAASKE+L VS DH+ Y+ LLK LIVQSLLRLKEPAVLLRCR++D H V  VL SA+EEY +K  V  PE+IVD  I+L P P  +++H  SCSGGVV AS
Sbjct:   12 QMVRFMRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYERKAKQVDVRRKIEYSMQLNASRIKVLQAQDDLVNAMKEAASKELLLVSGDHHQYRNLLKELIVQSLLRLKEPAVLLRCREEDKHHVHRVLHSAREEYGEKACVSHPEVIVD-DIHLPPAPTSYDSHELSCSGGVVMAS 193          

HSP 2 Score: 45.0542 bits (105), Expect = 2.953e-62
Identity = 22/30 (73.33%), Postives = 26/30 (86.67%), Query Frame = 2
Query:  551 RDGEIVCENTLDARLGVVFR*QLPEIRKRL 640
            RDG+IV ENTLDARL V FR +LP+IRK+L
Sbjct:  194 RDGKIVFENTLDARLEVAFRKKLPQIRKQL 223          
BLAST of EY692326 vs. ExPASy Swiss-Prot
Match: VATE3_ARATH (V-type proton ATPase subunit E3 OS=Arabidopsis thaliana GN=VHA-E3 PE=2 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 1.451e-61
Identity = 116/189 (61.38%), Postives = 137/189 (72.49%), Query Frame = 1
Query:    1 QMVRFIRPLAEEKADEISVSAE*EFNIEKLQLVEAEKKKIXXXXXXXXXXXXXXXXIEYSMQLNASRIKVLQAQDDLVSNMMEAASKEVLNVSRD------HNSYKKLLKGLIVQSLLRLKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHQIYLRPGPGHHNAHGPSCSGGVVGAS 549
            QMVRFIR  AEEKA+EIS+S+E EFNIEKLQLVEAEKKKI                I+YSMQLNASRIKVLQAQDD+V+ M E A+K++L VS+       H+ YK LLK LIVQ LLRLKEPAVLLRCR++D  +VES+L+ A EEY +K +VH PEIIVD  I+L P P   + H  SC+GGVV AS
Sbjct:   12 QMVRFIRQEAEEKANEISISSEEEFNIEKLQLVEAEKKKIRQEYEKKEKQVDVRKKIDYSMQLNASRIKVLQAQDDIVNAMKEEAAKQLLKVSQHGFFNHHHHQYKHLLKDLIVQCLLRLKEPAVLLRCREEDLDIVESMLDDASEEYCKKAKVHAPEIIVDKDIFLPPAPSDDDPHALSCAGGVVLAS 200          

HSP 2 Score: 50.0618 bits (118), Expect = 1.451e-61
Identity = 25/34 (73.53%), Postives = 27/34 (79.41%), Query Frame = 2
Query:  551 RDGEIVCENTLDARLGVVFR*QLPEIRKRLLRHV 652
            RDG+IVCENTLDARL V FR +LPEIRK L   V
Sbjct:  201 RDGKIVCENTLDARLEVAFRNKLPEIRKSLFGKV 234          
BLAST of EY692326 vs. ExPASy Swiss-Prot
Match: VATE2_ARATH (V-type proton ATPase subunit E2 OS=Arabidopsis thaliana GN=VHA-E2 PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 1.564e-57
Identity = 105/185 (56.76%), Postives = 137/185 (74.05%), Query Frame = 1
Query:    1 QMVRFIRPLAEEKADEISVSAE*EFNIEKLQLVEAEKKKIXXXXXXXXXXXXXXXXIEYSMQLNASRIKVLQAQDDLVSNMMEAASKEVLNVSRDHNSYKKLLKGLIVQSLLRLKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHQIYLRPGPGHH--NAHGPSCSGGVVGAS 549
            QMVRFIR  AEEKA+EIS+SAE EFNIE+LQL+E+ K+K+                I+YS QLNASRIK LQAQDD+V+ M ++A+K++L VS D N+YKKLLK LI++SLLRLKEP+VLLRCR+ D  +VESV+E AK +YA+K +V  P+I +D +++L P P     ++H P CSGGVV AS
Sbjct:   12 QMVRFIRQEAEEKANEISISAEEEFNIERLQLLESAKRKLRQDYDRKLKQVDIRKRIDYSTQLNASRIKYLQAQDDVVTAMKDSAAKDLLRVSNDKNNYKKLLKSLIIESLLRLKEPSVLLRCREMDKKVVESVIEDAKRQYAEKAKVGSPKITIDEKVFLPPPPNPKLPDSHDPHCSGGVVLAS 196          

HSP 2 Score: 47.7506 bits (112), Expect = 1.564e-57
Identity = 22/31 (70.97%), Postives = 27/31 (87.10%), Query Frame = 2
Query:  551 RDGEIVCENTLDARLGVVFR*QLPEIRKRLL 643
            +DG+IVCENTLDARL V FR +LP+IR RL+
Sbjct:  197 QDGKIVCENTLDARLDVAFRQKLPQIRTRLV 227          
BLAST of EY692326 vs. ExPASy Swiss-Prot
Match: VATE_HETSC (V-type proton ATPase subunit E OS=Heterodera schachtii PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.065e-23
Identity = 61/162 (37.65%), Postives = 91/162 (56.17%), Query Frame = 1
Query:    4 MVRFIRPLAEEKADEISVSAE*EFNIEKLQLVEAEKKKIXXXXXXXXXXXXXXXXIEYSMQLNASRIKVLQAQDDLVSNMMEAASKEVLNVSRDHNSYKKLLKGLIVQSLLRLKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHQIYLRP 489
            M+ FI   A EKA+EI   AE EFNIEK +LV+ +++KI                I+ S   N SR+K L+A+DD + N++E A   +  +S D   Y  +LKGL++Q L +L E  V+LRCRK D  +V  +L    EE  Q+   +  E+ +D++ +L P
Sbjct:   15 MMAFIEQEANEKAEEIDAKAEEEFNIEKGKLVQLQRQKIMEYYEKKEKQVELQRKIQRSNMQNQSRLKCLKARDDHLKNVLEEARANLSKISADRERYPAILKGLLLQGLFQLLESKVVLRCRKKDEEMVARILPECLEE-VQRTWGNRSEVKIDNEHFLSP 175          

HSP 2 Score: 25.0238 bits (53), Expect = 2.065e-23
Identity = 12/32 (37.50%), Postives = 20/32 (62.50%), Query Frame = 2
Query:  545 LPRDGEIVCENTLDARLGVVFR*QLPEIRKRL 640
            L +DG+I   +TL+ARL ++     P++R  L
Sbjct:  184 LAKDGKIRVSSTLEARLDLIADKITPQVRTAL 215          
BLAST of EY692326 vs. ExPASy Swiss-Prot
Match: VATE2_BOVIN (V-type proton ATPase subunit E 2 OS=Bos taurus GN=ATP6V1E2 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.065e-23
Identity = 60/160 (37.50%), Postives = 90/160 (56.25%), Query Frame = 1
Query:    4 MVRFIRPLAEEKADEISVSAE*EFNIEKLQLVEAEKKKIXXXXXXXXXXXXXXXXIEYSMQLNASRIKVLQAQDDLVSNMMEAASKEVLNVSRDHNSYKKLLKGLIVQSLLRLKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHQIYL 483
            M+ FI   A EKA+EI   AE EFNIEK +LV+ ++ KI                I+ S   N +R+KVL+A++DL+S ++  A   +  +  D   Y+ LL  L++Q LLRL EP V++RCR  DH LVE+ ++ A  +Y   +     E+ VD ++ L
Sbjct:   15 MMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSTLRNQARLKVLRARNDLISELLNDAKLRLSRIVTDPEFYQGLLDKLVLQGLLRLLEPVVIVRCRPQDHFLVEAAVQRAIPQYT-AVSHRCVEVQVDKEVQL 173          

HSP 2 Score: 28.8758 bits (63), Expect = 2.065e-23
Identity = 13/29 (44.83%), Postives = 21/29 (72.41%), Query Frame = 2
Query:  554 DGEIVCENTLDARLGVVFR*QLPEIRKRL 640
            D  I+  NTL++RL ++ + ++PEIRK L
Sbjct:  187 DQRIMVSNTLESRLDLLSQQKMPEIRKAL 215          
The following BLAST results are available for this feature:
BLAST of EY692326 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
VATE_CITUN2.505e-9187.43V-type proton ATPase subunit E OS=Citrus unshiu GN... [more]
VATE_CITLI1.611e-9086.89V-type proton ATPase subunit E OS=Citrus limon GN=... [more]
VATE_GOSHI4.274e-7070.16V-type proton ATPase subunit E OS=Gossypium hirsut... [more]
VATE_SPIOL1.919e-6769.95V-type proton ATPase subunit E OS=Spinacia olerace... [more]
VATE1_ARATH4.228e-6465.57V-type proton ATPase subunit E1 OS=Arabidopsis tha... [more]
VATE_MESCR2.953e-6267.21V-type proton ATPase subunit E OS=Mesembryanthemum... [more]
VATE3_ARATH1.451e-6161.38V-type proton ATPase subunit E3 OS=Arabidopsis tha... [more]
VATE2_ARATH1.564e-5756.76V-type proton ATPase subunit E2 OS=Arabidopsis tha... [more]
VATE_HETSC2.065e-2337.65V-type proton ATPase subunit E OS=Heterodera schac... [more]
VATE2_BOVIN2.065e-2337.50V-type proton ATPase subunit E 2 OS=Bos taurus GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C2-003-059-B03-CT.F Sweet orange bark, greenhouse plant Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY692326 ID=EY692326; Name=EY692326; organism=Citrus sinensis; type=EST; length=1019bp
CAGATGGTGCGGTTTATCCGCCCTTTAGCCGAAGAGAAAGCCGACGAGAT
CTCAGTTTCTGCCGAATAAGAATTCAACATAGAGAAGTTGCAGCTGGTGG
AAGCAGAGAAGAAGAAGATCAGACAAGAGTACGAGCGGAAAGAGAAGCAA
GTCGAAGTCAGAAAGAAGATTGAGTACTCCATGCAGCTGAATGCTTCTCG
GATCAAAGTTCTTCAAGCTCAGGATGATTTGGTCAGTAATATGATGGAGG
CAGCATCGAAGGAGGTTTTGAATGTGAGTCGAGATCACAATTCATATAAG
AAGCTTTTGAAGGGTCTTATTGTTCAGAGTTTGCTCAGGCTGAAAGAGCC
AGCTGTGTTACTGAGATGCCGCAAAGATGACCATCATTTGGTGGAGTCTG
TTTTGGAGTCAGCGAAAGAGGAATATGCACAGAAATTGCAAGTTCACCCA
CCAGAGATAATTGTGGATCATCAGATCTATCTTCGGCCTGGCCCTGGCCA
TCATAATGCCCATGGTCCATCCTGCTCAGGAGGGGTCGTGGGGGCTTCCT
CGAGATGGGGAGATAGTATGTGAGAATACCCTTGATGCCCGGTTGGGAGT
TGTGTTCCGATAGCAACTGCCTGAGATTCGGAAGCGACTCCTCAGACATG
TTGCTTGATTCATGAGATGATTTGTAAATGGATTGTCACACAACTAGAAA
ATTCATAGACAAAAATTTTTGAAAGATAAGCGTTCGAGCACTAAAAATTC
TATTATGACCATTGGTGTGAAGCACCACATATATTAATTAAAAGGGGACG
TGTGGAAATTGATGACATGAATGAACATGATTAAAGAGAAGTAATGAATG
AAGAAAGGGAGGTGTAGGCAGGACTACGTAAATGTTGAAAAATGAGATAT
AGCTGAGTGAGCGGATGTGAAATTGTGATAGATAATAAAGAGTGATGAGG
GTATTGGATGTAGATGGGTGGGTGACAGGTGGTTGAGGTGAGTGCGTGGG
TGGCGGGAGTATGGGTTGC
back to top