EY692065

Overview
NameEY692065
Unique NameEY692065
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1002
Libraries
Library NameType
Sweet orange bark, greenhouse plantcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY692065 vs. ExPASy Swiss-Prot
Match: FA18_ARATH (Uncharacterized FAM18-like protein At1g09330 OS=Arabidopsis thaliana GN=At1g09330 PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 2.301e-35
Identity = 69/82 (84.15%), Postives = 77/82 (93.90%), Query Frame = 1
Query:   34 NKKDSWLFWWTLYLSAVAWIVLGIFSLIRFQADYLLVVGVCLTLSIANIIGFTKCRKDAKKQIQQFASQTIASGFTSTLQSA 279
            NKKDSWLFWWTLYL+A AW +LG+FSLIRFQADYLLVVGVCL+L++ANIIGFTKC+KDAKKQ QQFASQTIAS F ST+QSA
Sbjct:  101 NKKDSWLFWWTLYLAAAAWFILGVFSLIRFQADYLLVVGVCLSLNVANIIGFTKCKKDAKKQFQQFASQTIASRFQSTVQSA 182          
The following BLAST results are available for this feature:
BLAST of EY692065 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
FA18_ARATH2.301e-3584.15Uncharacterized FAM18-like protein At1g09330 OS=Ar... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C2-003-106-C12-CT.F Sweet orange bark, greenhouse plant Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY692065 ID=EY692065; Name=EY692065; organism=Citrus sinensis; type=EST; length=1002bp
CCGGGGATTTCCCGGGGTCGACCACGCGTCCGGAACAAGAAAGATTCGTG
GCTATTCTGGTGGACCCTTTACCTTTCGGCTGTTGCTTGGATTGTGCTTG
GGATATTTTCTCTCATTAGGTTCCAAGCTGATTATCTCCTGGTTGTTGGT
GTCTGTTTGACCCTCAGCATTGCAAACATTATTGGTTTTACCAAATGCCG
AAAAGATGCTAAGAAGCAGATCCAACAATTTGCCTCCCAGACCATCGCAT
CCGGATTCACATCTACCCTACAGTCAGCTTTCAGTGTTGTCTGATTCAGT
TAGAGAAGCTGGGTGTAAGGTGGACCAGTAAACTTGCTCGTGGAAGATAT
GTTGAGAAGGGAGTGGTGGCCTTGTACAAACTTGCCTGTATGGATCGGCT
TATTTTTGAACTCTATGGGAAAACAAATTAGTAGATGTATTTGTATAACC
TTCTGGAGTTACTGGTATTCGTATAATGAAATTACAGGAAAAATTCATTT
ATAGAACAATAAGTTCTTTTTTGGCATTTAGCGTACTTGGTTTTCTTGGT
TCAATCCTTTTGTAATCAATCTTTTTTGGTTGTTATCAAAGTTTGAGGAA
AATGTGGAAGCTTTGGTTTCCTATTTTTAAAAAAATTATAAAAACATCAA
AATGAATAAAATAAAAAATAAAATATAAAATGATTAAAAAAAAAAAAAGA
TGAATAAAAAATATTAAATGGGGGGGCGGCCCCCTTTAAGGGTACCAAAT
TTAAAATTCCGTGGGGTTGCCGAAGGCCAAAATCCTTTTATTAGGGGGCC
CCCAAAATATATCATCTCCGGGGGCCGGCCTTTTTTAAAAACGTCTGGGG
GAGGGGGGAAAAACCCTTTGGGGTTCTCCCAATTTATATTCCCCCTTTTG
GCCACATCATCCCCCCCTTTTTTCACCACAGTAGGGTGATTAAAATACAA
AAAGAAAAGGCCCCGCCCCCCGGAAAATCCACCCCTTCCCCCACAAAAAA
AG
back to top