EY692059

Overview
NameEY692059
Unique NameEY692059
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1054
Libraries
Library NameType
Sweet orange bark, greenhouse plantcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY692059 vs. ExPASy Swiss-Prot
Match: TPS1_ARATH (Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Arabidopsis thaliana GN=TPS1 PE=1 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 4.483e-37
Identity = 86/161 (53.42%), Postives = 103/161 (63.98%), Query Frame = 1
Query:    7 SEEDXTAIDYVLCIGHFLGKDEDVYAFFEPELPDDGPGIPRTRPTD---AIKVPGERR-----------QALKVASRGSSKISQGKTQRPAQAPEKKTPNHNCTNVRQPSSDKTSYNVLDLNKENYFSCAVGRPRTNARFLLQSSDEVVSFLKKLADASSS 447
            S+   T IDYVLCIGHFLGKDEDVY FFEPELP D P I R+RP+    A    G+RR              K +S  +S  +   +QR  Q+  K   NH+  N R+PS +K S+NVLDL  ENYFSCAVGR RTNAR+LL S D+VV FL+KLAD +SS
Sbjct:  781 SKSMTTPIDYVLCIGHFLGKDEDVYTFFEPELPSDMPAIARSRPSSDSGAKSSSGDRRPPSKSTHNNNKSGSKSSSSSNSNNNNKSSQRSLQSERKSGSNHSLGNSRRPSPEKISWNVLDLKGENYFSCAVGRTRTNARYLLGSPDDVVCFLEKLADTTSS 941          
The following BLAST results are available for this feature:
BLAST of EY692059 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
TPS1_ARATH4.483e-3753.42Alpha,alpha-trehalose-phosphate synthase [UDP-form... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C2-003-106-C02-CT.F Sweet orange bark, greenhouse plant Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY692059 ID=EY692059; Name=EY692059; organism=Citrus sinensis; type=EST; length=1054bp
CCCGCGTCCGAAGAAGATGNAACAGCAATCGACTATGTGCTGTGTATTGG
ACATTTTCTGGGGAAGGATGAAGATGTGTATGCGTTTTTTGAGCCAGAAC
TCCCTGATGATGGCCCGGGCATTCCAAGAACCAGACCAACAGATGCAATA
AAGGTACCAGGGGAGCGAAGACAAGCATTGAAGGTAGCAAGTAGAGGCAG
CTCAAAGATATCTCAAGGTAAGACGCAGCGACCTGCCCAAGCTCCCGAGA
AAAAAACCCCGAATCACAACTGTACTAATGTACGGCAGCCATCATCGGAT
AAGACGTCCTACAATGTGCTTGATCTCAATAAAGAGAACTACTTCTCCTG
TGCTGTGGGGCGACCTCGTACAAATGCCCGGTTTCTACTTCAGTCATCGG
ATGAGGTCGTCTCATTTCTAAAGAAGCTAGCTGACGCATCGTCGTCACAT
GAAGCACACAATGGTCCAACTTAAGAAACGTTTTCAGCTTGCATGCTTGC
GACGTTGCATCTGATTCTAAGGCCCAAGAACCAAGCCCCAAAATTGAAGG
TACCGAAAGAGATGACAGATGAGTTCCCCTGCTTACTGGGAAATTGATCC
TCCCCATGGTTTCGAAAAGATAGGGATATTAAATTGACTCGAAATGGGTT
GGGGGGGAACCAAAGCTTAATTTCGTTGTATGAAACCGGGTTCCTAAGAA
AAAATCCTGGAACCACAGGCTTGTTCCTTCATTGAAAGAATCCTTTTAAG
AAAAAAAAAAAAAATTTGTTTGGCCCCCCTTGCAATTCAGGTTTCAGTAA
TATATTATAAATTTGAAATCACGATGAAAATTACAAATCTTTAAGTATCC
TTGATCCGCAGAACCCTAATATCTATAAGTAACACCAATCCCCAGCACAA
GGATTAAACCCAACTAACTTTCTTTCACTGACACTAGGTATAATATACCA
TCTTGCATTACGCTTACTCTTGCCGTGAACACTCTACAGTGGATATAGTT
CGACATAGATGTTGTATACGATACACACTACGGAAACTAAACTACTAACG
ACAC
back to top