EY684811
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY684811 vs. ExPASy Swiss-Prot
Match: C3H38_ARATH (Zinc finger CCCH domain-containing protein 38 OS=Arabidopsis thaliana GN=At3g18640 PE=1 SV=1) HSP 1 Score: 99.3673 bits (246), Expect = 3.254e-20 Identity = 52/82 (63.41%), Postives = 60/82 (73.17%), Query Frame = 1 Query: 43 LRAFWLPQAEFVKDLLKPTWKESHIIKHAYENIVNKVLDKVIGTMQGAANIPQTQEKIDQYLSFSKSKLTKLVQAYVEKSRK 288 +RAF E VK+LLKP WKE + K Y+NIV KV +KV GTMQ + N+PQTQEKID YLS SK KLTKLVQAYV K +K Sbjct: 595 MRAFKFALVEVVKELLKPAWKEGKLNKDGYKNIVKKVAEKVTGTMQ-SGNVPQTQEKIDHYLSASKPKLTKLVQAYVGKIKK 675
BLAST of EY684811 vs. ExPASy Swiss-Prot
Match: C3H55_ORYSJ (Zinc finger CCCH domain-containing protein 55 OS=Oryza sativa subsp. japonica GN=Os08g0135800 PE=2 SV=1) HSP 1 Score: 87.0409 bits (214), Expect = 1.671e-16 Identity = 45/82 (54.88%), Postives = 58/82 (70.73%), Query Frame = 1 Query: 43 LRAFWLPQAEFVKDLLKPTWKESHIIKHAYENIVNKVLDKVIGTMQGAANIPQTQEKIDQYLSFSKSKLTKLVQAYVEKSRK 288 L+ F L A+FVKD LKPTWKE + + ++ IV KV+DKV T++ N PQT+EKID Y+S+S+ KL KLVQAYV K K Sbjct: 878 LKMFKLALADFVKDALKPTWKEGQMSREVHKTIVKKVVDKVTTTVE---NTPQTKEKIDIYMSYSREKLNKLVQAYVGKYAK 956
BLAST of EY684811 vs. ExPASy Swiss-Prot
Match: C3H27_ARATH (Zinc finger CCCH domain-containing protein 27 OS=Arabidopsis thaliana GN=FES1 PE=2 SV=2) HSP 1 Score: 69.3218 bits (168), Expect = 3.606e-11 Identity = 32/90 (35.56%), Postives = 50/90 (55.56%), Query Frame = 1 Query: 19 RGALSLELLRAFWLPQAEFVKDLLKPTWKESHIIKHAYENIVNKVLDKVIGTMQGAANIPQTQEKIDQYLSFSKSKLTKLVQAYVEKSRK 288 R ++++R F E +K++LKP W+E + K + IV K +KV+G +P E +DQYL S +++ KLV+ YVEK K Sbjct: 497 RSDAGMKVMRLFRTAVVETIKEMLKPLWREGRLTKDVHNMIVKKAAEKVVGAAVQFHQVPTDTESVDQYLGLSGTRIVKLVEGYVEKYGK 586 The following BLAST results are available for this feature:
BLAST of EY684811 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY684811 ID=EY684811; Name=EY684811; organism=Citrus sinensis; type=EST; length=946bpback to top |