EY684771

Overview
NameEY684771
Unique NameEY684771
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length854
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY684771_ssr372 microsatellite EY684771_ssr372:372..392. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY684771 vs. ExPASy Swiss-Prot
Match: SIN3_ARATH (Paired amphipathic helix protein Sin3 OS=Arabidopsis thaliana GN=SIN3 PE=1 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 2.508e-21
Identity = 59/104 (56.73%), Postives = 71/104 (68.27%), Query Frame = 3
Query:  396 AQKLTTNDALTYLKAVKDIFQDKREKYDDFLEVMKDFKAQRIDTAGVIARVKELFKGQ*RTIFGVS--IPS*QRAMKSHLHFENEHPIPSNTGNIEKAIIFKNQ 701
            AQKLTTNDAL YLKAVKD FQD+R KYD+FLEVMK+FK+QR+DTAGVI RVKELFKG    I G +  +P   +  +  L  E+  P        E+AI F N+
Sbjct:   30 AQKLTTNDALAYLKAVKDKFQDQRGKYDEFLEVMKNFKSQRVDTAGVITRVKELFKGHQELILGFNTFLP---KGFEITLQPEDGQPPLKKRVEFEEAISFVNK 130          
BLAST of EY684771 vs. ExPASy Swiss-Prot
Match: WRK19_ARATH (Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 6.138e-14
Identity = 38/61 (62.30%), Postives = 46/61 (75.41%), Query Frame = 3
Query:  405 LTTNDALTYLKAVKDIFQDKREKYDDFLEVMKDFKAQRIDTAGVIARVKELFKGQ*RTIFG 587
            +TT DAL YLKAVKD F+D  EKYD FLEV+ D K Q +DT+GVIAR+K+LFKG    + G
Sbjct:  304 VTTGDALNYLKAVKDKFEDS-EKYDTFLEVLNDCKHQGVDTSGVIARLKDLFKGHDDLLLG 363          

HSP 2 Score: 24.6386 bits (52), Expect = 6.138e-14
Identity = 9/13 (69.23%), Postives = 12/13 (92.31%), Query Frame = 2
Query:  587 GFNTFLAKGYEIT 625
            GFNT+L+K Y+IT
Sbjct:  363 GFNTYLSKEYQIT 375          
BLAST of EY684771 vs. ExPASy Swiss-Prot
Match: PST3_SCHPO (Paired amphipathic helix protein pst3 OS=Schizosaccharomyces pombe GN=pst3 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 3.126e-12
Identity = 36/68 (52.94%), Postives = 47/68 (69.12%), Query Frame = 3
Query:  405 LTTNDALTYLKAVKDIFQDKREKYDDFLEVMKDFKAQRIDTAGVIARVKELFKGQ*RTI--FGVSIPS 602
            L  NDAL+YL+ VK  F ++RE Y+ FLE+M+DFK+Q +DT GVI RV ELF G  + I  F   +PS
Sbjct:  113 LDVNDALSYLELVKYYFSERREIYNRFLEIMRDFKSQALDTLGVINRVSELFNGYPQLIEGFNTFLPS 180          

HSP 2 Score: 23.8682 bits (50), Expect = 3.126e-12
Identity = 9/12 (75.00%), Postives = 10/12 (83.33%), Query Frame = 2
Query:  587 GFNTFLAKGYEI 622
            GFNTFL  GY+I
Sbjct:  173 GFNTFLPSGYKI 184          
BLAST of EY684771 vs. ExPASy Swiss-Prot
Match: SIN3A_HUMAN (Paired amphipathic helix protein Sin3a OS=Homo sapiens GN=SIN3A PE=1 SV=2)

HSP 1 Score: 66.2402 bits (160), Expect = 2.514e-11
Identity = 33/63 (52.38%), Postives = 44/63 (69.84%), Query Frame = 3
Query:  399 QKLTTNDALTYLKAVKDIFQDKREKYDDFLEVMKDFKAQRIDTAGVIARVKELFKGQ*RTIFG 587
            Q+L   DAL+YL  VK  F  + + Y+DFL++MK+FK+Q IDT GVI+RV +LFKG    I G
Sbjct:  119 QRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMG 181          

HSP 2 Score: 23.483 bits (49), Expect = 2.514e-11
Identity = 9/12 (75.00%), Postives = 10/12 (83.33%), Query Frame = 2
Query:  587 GFNTFLAKGYEI 622
            GFNTFL  GY+I
Sbjct:  181 GFNTFLPPGYKI 192          
The following BLAST results are available for this feature:
BLAST of EY684771 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
SIN3_ARATH2.508e-2156.73Paired amphipathic helix protein Sin3 OS=Arabidops... [more]
WRK19_ARATH6.138e-1462.30Probable WRKY transcription factor 19 OS=Arabidops... [more]
PST3_SCHPO3.126e-1252.94Paired amphipathic helix protein pst3 OS=Schizosac... [more]
SIN3A_HUMAN2.514e-1152.38Paired amphipathic helix protein Sin3a OS=Homo sap... [more]
back to top
Libraries
Library NameType
Sweet orange bark, greenhouse plantcdna_library
Properties
Property NameValue
Genbank descriptionCS00-C2-003-003-D11-CT.F Sweet orange bark, greenhouse plant Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY684771 ID=EY684771|Name=EY684771|organism=Citrus sinensis|type=EST|length=854bp
CTGTTTTAATTATCATATTCCCTCTGTCAAACCATTGTTAAAAATTCACA
AAATCCTCAAAAAAATTTCAAGGGAAAAATAAAAAACGAAAGCCTTTGTT
TTCCTGTAATTAACTCTCGAAACAAGAAGCGTCTTTGTGAAGACTTTTTC
TCATTTTTGCGTTGTTGCTAATTTGCCGACGAAACGATCTTCCTATCTTC
ATTGATTTTCGTGTTTAATTGAAGTTGAAAGCATGATTTGAGAAAGATAG
AGAGTTTTTGTTTTCGTTTTACGAGATGAAGAGGTCCAGAGACGAGGTTT
ACATGAACTCTCAAATTAAACGGCCGATGATTTCTTCACGAGGAGAACCC
TCTGGGCAGACCCAAGTGGTGGGAGGAGGAGGAGGAGGAGGAGGTGCACA
GAAGTTAACAACAAATGATGCCCTAACATATCTCAAGGCTGTTAAGGACA
TATTTCAAGACAAAAGGGAGAAATACGATGACTTTCTTGAAGTTATGAAA
GACTTCAAAGCCCAAAGAATTGACACAGCAGGTGTCATAGCGAGGGTAAA
GGAGCTGTTTAAAGGGCAATAAAGAACTATTTTTGGGGTTTCAATACCTT
CCTAGCAAAGGGCTATGAAATCACACCTCCACTTTGAGAATGAACACCCT
ATCCCAAGCAACACGGGTAATATTGAAAAAGCTATAATTTTTAAAAACCA
AAATTGACACAGAATGTCAAGGCGGCGATCTAGTTTTCACACCCTTTTTC
GACATCCCGAAAAAGGCACACAAAGGGAAAGCGGGCCGACCAGCGAACGC
CAACCAGAAAGAACCAGCACCCCAACCACACCGGCCCAACAACCTTGCAG
GAAA
back to top