EY684760

Overview
NameEY684760
Unique NameEY684760
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length911
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY684760_ssr183 microsatellite EY684760_ssr183:183..192. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY684760 vs. ExPASy Swiss-Prot
Match: P2C08_ORYSJ (Probable protein phosphatase 2C 8 OS=Oryza sativa subsp. japonica GN=Os01g0656200 PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 4.307e-22
Identity = 55/108 (50.93%), Postives = 71/108 (65.74%), Query Frame = 3
Query:  243 VFVSLNHVGDQYLKPFVISKPDVMVTERSDRDEFLILASDGLWDVVSNEAACQVVRRCFSGRI--KWASSVDAGNQNPXXXXXXXXXXXXISRGSSDNISVIVVELNK 560
            V  +   +GD YLKP+VI++P+V V +R+D+DEFLILASDGLWDVVSN+ AC++ R C SGR   K+  SV     +             ISRGS DNISV+VVEL +
Sbjct:  286 VLATSRSIGDYYLKPYVIAEPEVTVMDRTDKDEFLILASDGLWDVVSNDVACKIARNCLSGRAASKYPESVSG---STAADAAALLVELAISRGSKDNISVVVVELRR 390          
BLAST of EY684760 vs. ExPASy Swiss-Prot
Match: P2C51_ORYSJ (Probable protein phosphatase 2C 51 OS=Oryza sativa subsp. japonica GN=Os05g0572700 PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.253e-21
Identity = 55/114 (48.25%), Postives = 71/114 (62.28%), Query Frame = 3
Query:  243 VFVSLNHVGDQYLKPFVISKPDVMVTERSDRDEFLILASDGLWDVVSNEAACQVVRRCFSGR--------IKWASSVDAGNQNPXXXXXXXXXXXXISRGSSDNISVIVVELNK 560
            V  +   +GD YLKPFV ++P+V V ER+D+DEFLILASDGLWDVVSNE AC++ R C +GR        +  +S+ DA                 +SRGS DNISV+VVEL +
Sbjct:  271 VLATSRSIGDYYLKPFVSAEPEVRVVERTDKDEFLILASDGLWDVVSNEVACKIARNCLNGRAASMFPESVSGSSAADAA---------ALLAELAVSRGSRDNISVVVVELRR 375          
BLAST of EY684760 vs. ExPASy Swiss-Prot
Match: P2C78_ARATH (Probable protein phosphatase 2C 78 OS=Arabidopsis thaliana GN=At5g59220 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 8.980e-20
Identity = 53/119 (44.54%), Postives = 71/119 (59.66%), Query Frame = 3
Query:  264 VGDQYLKPFVISKPDVMVTERSDRDEFLILASDGLWDVVSNEAACQVVRRCFSGRI---------KWASSVDAGN---------QNPXXXXXXXXXXXXISRGSSDNISVIVVELNKPT 566
            +GD YLKP+VIS+P+V VT+R++ D+FLILASDGLWDVVSNE AC VVR C  G++         +  + V AGN                        ++R SSDN+SV+VV+L + T
Sbjct:  295 IGDNYLKPYVISRPEVTVTDRANGDDFLILASDGLWDVVSNETACSVVRMCLRGKVNGQVSSSPEREMTGVGAGNVVVGGGDLPDKACEEASLLLTRLALARQSSDNVSVVVVDLRRDT 413          
BLAST of EY684760 vs. ExPASy Swiss-Prot
Match: P2C68_ORYSJ (Probable protein phosphatase 2C 68 OS=Oryza sativa subsp. japonica GN=Os09g0325700 PE=2 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 2.212e-18
Identity = 51/100 (51.00%), Postives = 64/100 (64.00%), Query Frame = 3
Query:  264 VGDQYLKPFVISKPDVMVTERSDRDEFLILASDGLWDVVSNEAACQVVRRCF-SGRIKWASSVDAGNQNPXXXXXXXXXXXXISRGSSDNISVIVVELNK 560
            +GD YLKP+V + P+V VT RSD DE LILASDGLWDVVSNEAAC+V + C   GR +W +   A                 ++R SSDNISV+VV+L +
Sbjct:  266 IGDAYLKPYVTAVPEVTVTGRSDFDECLILASDGLWDVVSNEAACEVAQSCLRRGRQRWCAEAAA-----------VLTKLALARRSSDNISVVVVDLRR 354          
BLAST of EY684760 vs. ExPASy Swiss-Prot
Match: P2C37_ARATH (Protein phosphatase 2C 37 OS=Arabidopsis thaliana GN=PP2CA PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 3.773e-18
Identity = 49/99 (49.49%), Postives = 59/99 (59.60%), Query Frame = 3
Query:  264 VGDQYLKPFVISKPDVMVTERSDRDEFLILASDGLWDVVSNEAACQVVRRCFSGRIKWASSVDAGNQNPXXXXXXXXXXXXISRGSSDNISVIVVELNK 560
            +GD YLKP+VI  P+V VT+R+D DE LILASDGLWDVV NE AC V R C  G    A        N             ++R SSDN+SV+VV+L K
Sbjct:  295 IGDNYLKPYVIPDPEVTVTDRTDEDECLILASDGLWDVVPNETACGVARMCLRG--AGAGDDSDAAHNACSDAALLLTKLALARQSSDNVSVVVVDLRK 391          
BLAST of EY684760 vs. ExPASy Swiss-Prot
Match: P2C50_ORYSJ (Probable protein phosphatase 2C 50 OS=Oryza sativa subsp. japonica GN=Os05g0537400 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 7.115e-17
Identity = 53/109 (48.62%), Postives = 66/109 (60.55%), Query Frame = 3
Query:  264 VGDQYLKPFVISKPDVMVTERSDRDEFLILASDGLWDVVSNEAACQVVRRCF------SGRIKWASSVDAGNQNP-XXXXXXXXXXXXISRGSSDNISVIVVELNKPTK 569
            +GD+YLKPFVI KP+VMV  R+  D+ LILASDGLWDVVSNE AC+V RR        +G     S    G+ +P             + +GS DNI+VIVV+L KP K
Sbjct:  274 IGDRYLKPFVIPKPEVMVVPRAKDDDCLILASDGLWDVVSNEEACKVARRQILLWHKNNGAASPLSDEGEGSTDPAAQAAADYLMRLALKKGSEDNITVIVVDL-KPRK 381          
BLAST of EY684760 vs. ExPASy Swiss-Prot
Match: P2C49_ORYSJ (Probable protein phosphatase 2C 49 OS=Oryza sativa subsp. japonica GN=Os05g0457200 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.214e-16
Identity = 53/128 (41.41%), Postives = 67/128 (52.34%), Query Frame = 3
Query:  264 VGDQYLKPFVISKPDVMVTERSDRDEFLILASDGLWDVVSNEAACQVVRRCF---------------------------SGRIKWASSVD-AGNQNPXXXXXXXXXXXXISRGSSDNISVIVVELNKP 563
            +GD YLKP+V S+P+V VTER+D DE LILASDGLWDVV+NE AC+VVR CF                            G       VD A +               I+R S+DN+SV+VV+L +P
Sbjct:  287 IGDGYLKPYVTSEPEVTVTERADDDECLILASDGLWDVVTNEMACEVVRACFRSNGPPSPPGCSRPKAVLPPPAGASGGGGGDAVVKGVDKAESDKACADAALLLAKLAIARRSADNVSVVVVDLRRP 414          
BLAST of EY684760 vs. ExPASy Swiss-Prot
Match: P2C24_ARATH (Probable protein phosphatase 2C 24 OS=Arabidopsis thaliana GN=At2g29380 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 4.612e-16
Identity = 45/100 (45.00%), Postives = 62/100 (62.00%), Query Frame = 3
Query:  264 VGDQYLKPFVISKPDVMVTERSDRDEFLILASDGLWDVVSNEAACQVVRRCFSGRIKWASSVD-AGNQNPXXXXXXXXXXXXISRGSSDNISVIVVELNK 560
            +GD YLKP+V  +P+V +T+R D D+ LILASDGLWDVVSNE AC V R C  G  +   + D A +               ++R SSDN+SV+V++L +
Sbjct:  264 IGDNYLKPYVSCEPEVTITDRRD-DDCLILASDGLWDVVSNETACSVARMCLRGGGRRQDNEDPAISDKACTEASVLLTKLALARNSSDNVSVVVIDLRR 362          
BLAST of EY684760 vs. ExPASy Swiss-Prot
Match: P2C09_ORYSJ (Probable protein phosphatase 2C 9 OS=Oryza sativa subsp. japonica GN=Os01g0846300 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 6.023e-16
Identity = 51/126 (40.48%), Postives = 67/126 (53.17%), Query Frame = 3
Query:  264 VGDQYLKPFVISKPDVMVTERSDRDEFLILASDGLWDVVSNEAACQVVRRCF------------SGRIKWASSVDAGN---------------QNPXXXXXXXXXXXXISRGSSDNISVIVVELNK 560
            +GD YLKP+V S+P+V VTER+D DE LILASDGLWDVV+NE AC+VVR CF            SG    A + +  N                              ++R S+DN+SV+VV+L +
Sbjct:  287 IGDGYLKPYVTSEPEVTVTERTDDDECLILASDGLWDVVTNEMACEVVRACFHNNGPPAPAARPSGVPSSAEAAETENGGAASVKGISKAESSDKACSDAAMLLTKLALARRSADNVSVVVVDLRR 412          
BLAST of EY684760 vs. ExPASy Swiss-Prot
Match: P2C03_ARATH (Protein phosphatase 2C 3 OS=Arabidopsis thaliana GN=AIP1 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 3.904e-15
Identity = 35/53 (66.04%), Postives = 46/53 (86.79%), Query Frame = 3
Query:  264 VGDQYLKPFVISKPDVMVTERSDRDEFLILASDGLWDVVSNEAACQVVRRCFS 422
            +GD YLKP+V S+P+V VT+R++ DEFLILA+DGLWDVV+NEAAC +VR C +
Sbjct:  307 IGDNYLKPYVTSEPEVTVTDRTEEDEFLILATDGLWDVVTNEAACTMVRMCLN 359          
The following BLAST results are available for this feature:
BLAST of EY684760 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
P2C08_ORYSJ4.307e-2250.93Probable protein phosphatase 2C 8 OS=Oryza sativa ... [more]
P2C51_ORYSJ1.253e-2148.25Probable protein phosphatase 2C 51 OS=Oryza sativa... [more]
P2C78_ARATH8.980e-2044.54Probable protein phosphatase 2C 78 OS=Arabidopsis ... [more]
P2C68_ORYSJ2.212e-1851.00Probable protein phosphatase 2C 68 OS=Oryza sativa... [more]
P2C37_ARATH3.773e-1849.49Protein phosphatase 2C 37 OS=Arabidopsis thaliana ... [more]
P2C50_ORYSJ7.115e-1748.62Probable protein phosphatase 2C 50 OS=Oryza sativa... [more]
P2C49_ORYSJ1.214e-1641.41Probable protein phosphatase 2C 49 OS=Oryza sativa... [more]
P2C24_ARATH4.612e-1645.00Probable protein phosphatase 2C 24 OS=Arabidopsis ... [more]
P2C09_ORYSJ6.023e-1640.48Probable protein phosphatase 2C 9 OS=Oryza sativa ... [more]
P2C03_ARATH3.904e-1566.04Protein phosphatase 2C 3 OS=Arabidopsis thaliana G... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange bark, greenhouse plantcdna_library
Properties
Property NameValue
Genbank descriptionCS00-C2-003-003-C10-CT.F Sweet orange bark, greenhouse plant Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY684760 ID=EY684760|Name=EY684760|organism=Citrus sinensis|type=EST|length=911bp
CCACGCGTCCGACACAAATCACTCACCACTCAATTTAATGAATTGGATAG
TAATATGATTAGCATGATGAGTACATATACATGATGTTATCTTAAGTATA
TTAATTGGCTTGGATAACCGGCTAATTCTTCTTGAGCTAACTTTAGGCCC
ATAAGTTTTTATGATGAGGTTGATTTCATGGAATATATATATTTTTTAAA
ATTATTAAGAAAAGTTCTTATTAGTGCGGTCAATATAACGTGGTATTTGT
AAGTTTGAACCATGTAGGCGATCAATACTTGAAACCATTTGTGATATCAA
AGCCAGATGTGATGGTGACTGAAAGAAGCGACCGCGATGAATTCCTCATA
CTTGCTAGCGATGGCTTATGGGATGTTGTATCAAATGAAGCAGCATGCCA
AGTCGTGAGGAGATGTTTCAGCGGCCGGATAAAATGGGCATCCTCCGTCG
ACGCCGGGAACCAAAACCCCGCTGCCAGAGCAGCAGCAGTGCTGGTCGAG
CTAGCCATCTCTCGGGGCAGCAGTGACAATATAAGCGTCATAGTAGTTGA
GCTAAATAAACCTACCAAGTTTAATTCCTAGTGCATCATAAAATTTAATA
AACAGCAACAGAGTTCGTTTCGAAGATTTTAACCCTTGATTTGTTAAGCG
AAAAACCCGTGGTTTTCCAATCAAAAAATTGAAACCAAAAGCGGCGGGGA
CTCTAGCTGAATTCAACAAGCTTTTCAAGGGAGGCAATTATTTAAATTGC
AAAAAACACCCTGGTTATGATCACTAAGCAGCATCGGCCATTAGTGCCTG
CCCCACACCGCCCCACGACAGAAGACGACACTAAACCGGCAAACAGATGA
TTCACGGAATGCCCAACAGAATCAAACGGAACCAATGCAACAAGCCTCGA
CCCAGCGACGG
back to top