EY684750

Overview
NameEY684750
Unique NameEY684750
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length489
Libraries
Library NameType
Sweet orange bark, greenhouse plantcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10319 contig Csv1_Contig10319:731..1219. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY684750 vs. ExPASy Swiss-Prot
Match: PER4_VITVI (Peroxidase 4 OS=Vitis vinifera GN=GSVIVT00023967001 PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 8.315e-30
Identity = 67/126 (53.17%), Postives = 79/126 (62.70%), Query Frame = 2
Query:    2 MVALAGGHTVGKARCTSFRGHIYNDSNIDTSFARSLQQRCPRRGN--DNVLANLDRQTPTCFDXXXXXXXXXXXXXXHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQ 373
            MVAL+G HT+G+ARCTSFR  IYN++NID+SFA++ Q  CP      DN LA LD QTPT FD              HSDQ L+NG S D  VK Y  +   F  DF  GMIKMG+I PLTGS G+
Sbjct:  187 MVALSGAHTIGQARCTSFRARIYNETNIDSSFAKTRQASCPSASGSGDNNLAPLDLQTPTTFDNYYYKNLINQKGLLHSDQVLYNGGSTDSTVKTYVNNPKTFTSDFVAGMIKMGDITPLTGSEGE 312          
BLAST of EY684750 vs. ExPASy Swiss-Prot
Match: PER66_MAIZE (Peroxidase 66 OS=Zea mays GN=PER66 PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.048e-28
Identity = 62/124 (50.00%), Postives = 79/124 (63.71%), Query Frame = 2
Query:    2 MVALAGGHTVGKARCTSFRGHIYNDSNIDTSFARSLQQRCPRRGNDNVLANLDRQTPTCFDXXXXXXXXXXXXXXHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQ 373
            MVAL+G HT+G+A+C+SF  HIYND+NI+++FA SL+  CPR G+   LA LD  TP  FD              HSDQELFN  S D  V+ +A+S S F   FA  M+KMGN+ P TG+ GQ
Sbjct:  188 MVALSGAHTIGQAQCSSFNDHIYNDTNINSAFAASLRANCPRAGS-TALAPLDTTTPNAFDNAYYTNLLSQKGLLHSDQELFNSGSTDSTVRSFASSTSAFNSAFATAMVKMGNLSPQTGTQGQ 310          
BLAST of EY684750 vs. ExPASy Swiss-Prot
Match: PER42_MAIZE (Peroxidase 42 OS=Zea mays GN=PER42 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 5.959e-28
Identity = 61/124 (49.19%), Postives = 78/124 (62.90%), Query Frame = 2
Query:    2 MVALAGGHTVGKARCTSFRGHIYNDSNIDTSFARSLQQRCPRRGNDNVLANLDRQTPTCFDXXXXXXXXXXXXXXHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQ 373
            MVAL+G HT+G+A+C+SF GHIYND+NI+ +FA SL+  CP  G  + LA LD  TPT F               HSDQELFN  S D  V  +A+S + F   F   M+KMGN+ PLTG++GQ
Sbjct:  188 MVALSGAHTIGQAQCSSFNGHIYNDTNINAAFATSLKANCPMSGGSS-LAPLDTMTPTVFGNDYYKNLLSQKGLLHSDQELFNNGSTDSTVSNFASSSAAFTSAFTAAMVKMGNLGPLTGTSGQ 310          
BLAST of EY684750 vs. ExPASy Swiss-Prot
Match: PER1_ARAHY (Cationic peroxidase 1 OS=Arachis hypogaea GN=PNC1 PE=1 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 2.264e-27
Identity = 59/124 (47.58%), Postives = 77/124 (62.10%), Query Frame = 2
Query:    2 MVALAGGHTVGKARCTSFRGHIYNDSNIDTSFARSLQQRCPRRGNDNVLANLDRQTPTCFDXXXXXXXXXXXXXXHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQ 373
            +V L+G HT+G+A+CT+FR  IYN+SNID ++A+SLQ  CP  G D  L+  D  TP  FD              HSDQ+LFNG S D  V  Y+ + + F  DF   MIKMGN+ PLTG++GQ
Sbjct:  184 LVTLSGAHTIGQAQCTAFRTRIYNESNIDPTYAKSLQANCPSVGGDTNLSPFDVTTPNKFDNAYYINLRNKKGLLHSDQQLFNGVSTDSQVTAYSNNAATFNTDFGNAMIKMGNLSPLTGTSGQ 307          
BLAST of EY684750 vs. ExPASy Swiss-Prot
Match: PER70_MAIZE (Peroxidase 70 OS=Zea mays GN=PER70 PE=1 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 5.045e-27
Identity = 62/126 (49.21%), Postives = 80/126 (63.49%), Query Frame = 2
Query:    2 MVALAGGHTVGKARCTSFRGHIYNDSNIDTSFARSLQQRCPRR-GN-DNVLANLDRQTPTCFDXXXXXXXXXXXXXXHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQ 373
            +VAL+G HT+G A+C +FR HIYND+N++ +FA   +  CP   GN D  LA LD  TPT FD              HSDQ+LFNG + D LV+ YA++   F +DFA  MI+MGNI PLTG+ GQ
Sbjct:  187 LVALSGAHTIGLAQCKNFRAHIYNDTNVNAAFATLRRANCPAAAGNGDGNLAPLDTATPTAFDNAYYTNLLAQRGLLHSDQQLFNGGATDGLVRTYASTPRRFSRDFAAAMIRMGNISPLTGTQGQ 312          
BLAST of EY684750 vs. ExPASy Swiss-Prot
Match: PER67_ARATH (Peroxidase 67 OS=Arabidopsis thaliana GN=PER67 PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 6.588e-27
Identity = 63/126 (50.00%), Postives = 79/126 (62.70%), Query Frame = 2
Query:    2 MVALAGGHTVGKARCTSFRGHIYNDSNIDTSFARSLQQRCPRR--GNDNVLANLDRQTPTCFDXXXXXXXXXXXXXXHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQ 373
            MVAL+G HT+G+A+C +FR  IYN SNIDTSFA S ++ CP      DN  ANLD ++P  FD               SDQ LFN    D LV  Y+ +++ F++DFAR MIKMG+I PLTGS GQ
Sbjct:  182 MVALSGAHTIGRAQCVTFRNRIYNASNIDTSFAISKRRNCPATSGSGDNKKANLDVRSPDRFDHGFYKQLLSKKGLLTSDQVLFNNGPTDSLVIAYSHNLNAFYRDFARAMIKMGDISPLTGSNGQ 307          
BLAST of EY684750 vs. ExPASy Swiss-Prot
Match: PER1_WHEAT (Peroxidase OS=Triticum aestivum PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 8.605e-27
Identity = 60/125 (48.00%), Postives = 78/125 (62.40%), Query Frame = 2
Query:    2 MVALAGGHTVGKARCTSFRGHIYN-DSNIDTSFARSLQQRCPRRGNDNVLANLDRQTPTCFDXXXXXXXXXXXXXXHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQ 373
            MVAL+G HT+GKA+C++FR  IY  D+NI+T+FA SL+  CP+ G +  LANLD  TP  FD              HSDQ LFN  + D  V+ +A++ + F   F   MIKMGNI PLTG+ GQ
Sbjct:  178 MVALSGAHTIGKAQCSNFRTRIYGGDTNINTAFATSLKANCPQSGGNTNLANLDTMTPNAFDNAYYTNLLSQKGLLHSDQVLFNNETTDNTVRNFASNAAAFSSAFTTAMIKMGNIAPLTGTQGQ 302          
BLAST of EY684750 vs. ExPASy Swiss-Prot
Match: PER68_ARATH (Peroxidase 68 OS=Arabidopsis thaliana GN=PER68 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.917e-26
Identity = 62/126 (49.21%), Postives = 76/126 (60.32%), Query Frame = 2
Query:    2 MVALAGGHTVGKARCTSFRGHIYNDSNIDTSFARSLQQRCPRR--GNDNVLANLDRQTPTCFDXXXXXXXXXXXXXXHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQ 373
            MVAL+G HT+G+ARC +FR  IYN +NID SFA S ++ CP      DN  A LD +TP  FD               SDQ LFNG S D +V  Y+ S+  F++DF   MIKMG+I PLTGS GQ
Sbjct:  191 MVALSGAHTIGQARCVTFRSRIYNSTNIDLSFALSRRRSCPAATGSGDNNAAILDLRTPEKFDGSYFMQLVNHRGLLTSDQVLFNGGSTDSIVVSYSRSVQAFYRDFVAAMIKMGDISPLTGSNGQ 316          
BLAST of EY684750 vs. ExPASy Swiss-Prot
Match: PER2_ORYSJ (Peroxidase 2 OS=Oryza sativa subsp. japonica GN=PRX112 PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 4.270e-26
Identity = 58/126 (46.03%), Postives = 78/126 (61.90%), Query Frame = 2
Query:    2 MVALAGGHTVGKARCTSFRGHIYNDSNIDTSFARSLQQRCPRR--GNDNVLANLDRQTPTCFDXXXXXXXXXXXXXXHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQ 373
            MVAL+G HT+G+A+C +FR  +YN++NID+SFA +L+  CPR     D+ LA LD  TP  FD              HSDQ LFNG S D  V+ ++++ + F   F   M+KMGNI PLTG+ GQ
Sbjct:  180 MVALSGAHTIGQAQCQNFRDRLYNETNIDSSFATALKANCPRPTGSGDSNLAPLDTTTPNAFDSAYYTNLLSNKGLLHSDQVLFNGGSTDNTVRNFSSNTAAFNSAFTAAMVKMGNISPLTGTQGQ 305          
BLAST of EY684750 vs. ExPASy Swiss-Prot
Match: PER2_ORYSI (Peroxidase 2 OS=Oryza sativa subsp. indica GN=PRX112 PE=3 SV=2)

HSP 1 Score: 116.316 bits (290), Expect = 7.284e-26
Identity = 58/126 (46.03%), Postives = 78/126 (61.90%), Query Frame = 2
Query:    2 MVALAGGHTVGKARCTSFRGHIYNDSNIDTSFARSLQQRCPRR--GNDNVLANLDRQTPTCFDXXXXXXXXXXXXXXHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQ 373
            MVAL+G HT+G+A+C +FR  +YN++NID+SFA +L+  CPR     D+ LA LD  TP  FD              HSDQ LFNG S D  V+ ++++ + F   F   M+KMGNI PLTG+ GQ
Sbjct:  180 MVALSGAHTIGQAQCQNFRDRLYNETNIDSSFATALKANCPRPTGSGDSNLAPLDTTTPNAFDSAYYTNLLSNKGLLHSDQVLFNGGSTDNTVRNFSSNTAAFNSAFTVAMVKMGNISPLTGTQGQ 305          
The following BLAST results are available for this feature:
BLAST of EY684750 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 63
Match NameE-valueIdentityDescription
PER4_VITVI8.315e-3053.17Peroxidase 4 OS=Vitis vinifera GN=GSVIVT0002396700... [more]
PER66_MAIZE2.048e-2850.00Peroxidase 66 OS=Zea mays GN=PER66 PE=1 SV=1[more]
PER42_MAIZE5.959e-2849.19Peroxidase 42 OS=Zea mays GN=PER42 PE=2 SV=1[more]
PER1_ARAHY2.264e-2747.58Cationic peroxidase 1 OS=Arachis hypogaea GN=PNC1 ... [more]
PER70_MAIZE5.045e-2749.21Peroxidase 70 OS=Zea mays GN=PER70 PE=1 SV=1[more]
PER67_ARATH6.588e-2750.00Peroxidase 67 OS=Arabidopsis thaliana GN=PER67 PE=... [more]
PER1_WHEAT8.605e-2748.00Peroxidase OS=Triticum aestivum PE=2 SV=1[more]
PER68_ARATH1.917e-2649.21Peroxidase 68 OS=Arabidopsis thaliana GN=PER68 PE=... [more]
PER2_ORYSJ4.270e-2646.03Peroxidase 2 OS=Oryza sativa subsp. japonica GN=PR... [more]
PER2_ORYSI7.284e-2646.03Peroxidase 2 OS=Oryza sativa subsp. indica GN=PRX1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C2-003-003-B10-CT.F Sweet orange bark, greenhouse plant Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY684750 ID=EY684750; Name=EY684750; organism=Citrus sinensis; type=EST; length=489bp
CATGGTGGCTCTTGCTGGTGGACATACGGTAGGCAAGGCAAGGTGCACAT
CATTTCGAGGACACATTTACAACGATTCCAATATTGACACCAGCTTCGCC
AGGTCCTTGCAGCAGAGATGCCCAAGAAGAGGAAATGACAATGTTCTGGC
AAACCTTGACCGTCAAACTCCAACGTGCTTTGACAATTTATATTACAAGA
ATCTGTTGAACAAGAAGGGGCTTCTTCATTCTGACCAAGAGCTCTTTAAT
GGCAATTCTGCTGATTTTCTGGTCAAAAGATACGCTGCTAGCATCTCTGT
TTTTTTCAAGGACTTCGCCAGGGGTATGATCAAGATGGGCAACATCAAAC
CTCTCACAGGAAGTGCTGGACAGATCAGGATCAATTGCAGAAAAATCAAT
TGAAAAATTATCTGCATCTTGTAATAAGCTACAATATTTCTAATATGAAC
ATGTGTGGCGTTGTACGTAAAAAAAAAAAAAAAAAAAAA
back to top