EY684746

Overview
NameEY684746
Unique NameEY684746
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length904
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY684746 vs. ExPASy Swiss-Prot
Match: SCL8_ARATH (Scarecrow-like protein 8 OS=Arabidopsis thaliana GN=SCL8 PE=2 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 1.183e-48
Identity = 97/140 (69.29%), Postives = 114/140 (81.43%), Query Frame = 3
Query:   15 DESVSTENPRDELLRRVKGLSPSVVTLVEQETNTNTAPFMARVNEACAYYGALFDSIESTVLRDHSDRVKVEEGLSRKLANSVACEGRDRVERCEVFGKWRARMRMAGFELKPMSQIIAESMRNRLRWGGKRKTPRFSLQ 434
            DESV TENPRDELLRRVKGL P VVTLVEQE N+NTAPF+ RV+E+CA YGAL +S+ESTV   +SDR KVEEG+ RKL N+VACEG DR+ERCEVFGKWR RM MAGFEL P+S+ IAESM++R    G R  P F+++
Sbjct:  483 DESVCTENPRDELLRRVKGLKPRVVTLVEQEMNSNTAPFLGRVSESCACYGALLESVESTVPSTNSDRAKVEEGIGRKLVNAVACEGIDRIERCEVFGKWRMRMSMAGFELMPLSEKIAESMKSR----GNRVHPGFTVK 618          
BLAST of EY684746 vs. ExPASy Swiss-Prot
Match: PAT1_ARATH (Scarecrow-like transcription factor PAT1 OS=Arabidopsis thaliana GN=PAT1 PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 2.395e-33
Identity = 73/128 (57.03%), Postives = 92/128 (71.88%), Query Frame = 3
Query:   15 DESVSTENPRDELLRRVKGLSPSVVTLVEQETNTNTAPFMARVNEACAYYGALFDSIESTVLRDHSDRVKVEEG-LSRKLANSVACEGRDRVERCEVFGKWRARMRMAGFELKPMSQIIAESMRNRLR 395
            DESVSTEN RD LLR VK LSP VVTLVEQE+NTNTA F  R  E   YY A+F+SI+ T+ RDH  R+ VE+  L+R + N +ACEG DRVER E+ GKWR+R  MAGF   P+S ++  ++++ LR
Sbjct:  332 DESVSTENHRDRLLRMVKSLSPKVVTLVEQESNTNTAAFFPRFMETMNYYAAMFESIDVTLPRDHKQRINVEQHCLARDVVNIIACEGADRVERHELLGKWRSRFGMAGFTPYPLSPLVNSTIKSLLR 459          
BLAST of EY684746 vs. ExPASy Swiss-Prot
Match: SCL21_ARATH (Scarecrow-like protein 21 OS=Arabidopsis thaliana GN=SCL21 PE=1 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 2.028e-32
Identity = 69/128 (53.91%), Postives = 94/128 (73.44%), Query Frame = 3
Query:   15 DESVSTENPRDELLRRVKGLSPSVVTLVEQETNTNTAPFMARVNEACAYYGALFDSIESTVLRDHSDRVKVEEG-LSRKLANSVACEGRDRVERCEVFGKWRARMRMAGFELKPMSQIIAESMRNRLR 395
            DESVS EN RD LLR VK LSP VVTLVEQE NTNT+PF+ R  E  +YY A+F+SI+  + R+H +R+ +E+  ++R + N +ACEG +R+ER E+ GKW++R  MAGFE  P+S II+ ++R  LR
Sbjct:  255 DESVSMENHRDRLLRMVKSLSPKVVTLVEQECNTNTSPFLPRFLETLSYYTAMFESIDVMLPRNHKERINIEQHCMARDVVNIIACEGAERIERHELLGKWKSRFSMAGFEPYPLSSIISATIRALLR 382          
BLAST of EY684746 vs. ExPASy Swiss-Prot
Match: CIGR2_ORYSJ (Chitin-inducible gibberellin-responsive protein 2 OS=Oryza sativa subsp. japonica GN=CIGR2 PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 1.006e-31
Identity = 73/155 (47.10%), Postives = 100/155 (64.52%), Query Frame = 3
Query:   15 DESVSTENPRDELLRRVKGLSPSVVTLVEQETNTNTAPFMARVNEACAYYGALFDSIESTVLRDHSDRVKVEEG-LSRKLANSVACEGRDRVERCEVFGKWRARMRMAGFELKPMSQIIAESMRNRLRWGGKRKTPRFSLQTKTDPLALARKQKP 476
            DESVST N RD LLR VK LSP V+TLVE E+NTNTAPF  R  E   YY A+F+SI+ T+ RD  +R+ +E+  L+R++ N +ACEG +R ER E FGKW+AR+ MAGF   P+S ++  ++R  L    +  +  + L  +   L L  K +P
Sbjct:  386 DESVSTANHRDRLLRMVKSLSPKVLTLVEMESNTNTAPFPQRFAETLDYYTAIFESIDLTLPRDDRERINMEQHCLAREIVNLIACEGEERAERYEPFGKWKARLTMAGFRPSPLSSLVNATIRTLL----QSYSDNYKLAERDGALYLGWKSRP 536          
BLAST of EY684746 vs. ExPASy Swiss-Prot
Match: CIGR1_ORYSJ (Chitin-inducible gibberellin-responsive protein 1 OS=Oryza sativa subsp. japonica GN=CIGR1 PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 1.006e-31
Identity = 66/127 (51.97%), Postives = 90/127 (70.87%), Query Frame = 3
Query:   15 DESVSTENPRDELLRRVKGLSPSVVTLVEQETNTNTAPFMARVNEACAYYGALFDSIESTVLRDHSDRVKVEEG-LSRKLANSVACEGRDRVERCEVFGKWRARMRMAGFELKPMSQIIAESMRNRL 392
            DESV   NPRD LLR VKGLSP V TLVEQE++TNT PF+ R  E   YY A+F+SI++ + RD+ +R+ VE+  L++ + N +ACEG+DRVER E+ GKW++R+ MAGF   P+S  +   +R  L
Sbjct:  413 DESVDVNNPRDGLLRMVKGLSPKVTTLVEQESHTNTTPFLMRFGETMEYYSAMFESIDANLPRDNKERISVEQHCLAKDIVNIIACEGKDRVERHELLGKWKSRLTMAGFRPYPLSSYVNSVIRKLL 539          
BLAST of EY684746 vs. ExPASy Swiss-Prot
Match: SCL1_ARATH (Scarecrow-like protein 1 OS=Arabidopsis thaliana GN=SCL1 PE=2 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 2.928e-31
Identity = 67/128 (52.34%), Postives = 92/128 (71.88%), Query Frame = 3
Query:   15 DESVSTENPRDELLRRVKGLSPSVVTLVEQETNTNTAPFMARVNEACAYYGALFDSIESTVLRDHSDRVKVE-EGLSRKLANSVACEGRDRVERCEVFGKWRARMRMAGFELKPMSQIIAESMRNRLR 395
            DESV+T N RDELL  VK L+P +VT+VEQ+ NTNT+PF  R  EA  YY A+F+S++ T+ R+  +R+ VE + L+R + N VACEG +R+ER E  GKWRARM MAGF  KPMS  +  +++N ++
Sbjct:  434 DESVTTVNQRDELLHMVKSLNPKLVTVVEQDVNTNTSPFFPRFIEAYEYYSAVFESLDMTLPRESQERMNVERQCLARDIVNIVACEGEERIERYEAAGKWRARMMMAGFNPKPMSAKVTNNIQNLIK 561          
BLAST of EY684746 vs. ExPASy Swiss-Prot
Match: SCL5_ARATH (Scarecrow-like protein 5 OS=Arabidopsis thaliana GN=SCL5 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.113e-30
Identity = 72/155 (46.45%), Postives = 103/155 (66.45%), Query Frame = 3
Query:   15 DESVSTENPRDELLRRVKGLSPSVVTLVEQETNTNTAPFMARVNEACAYYGALFDSIESTVLRDHSDRVKVEEG-LSRKLANSVACEGRDRVERCEVFGKWRARMRMAGFELKPMSQIIAESMRNRLRWGGKRKTPRFSLQTKTDPLALARKQKP 476
            DESV+ EN RD LLR VK LSP+VVTLVEQE NTNTAPF+ R  E   +Y A+F+SI+  + RDH +R+ VE+  L+R++ N +ACEG +R ER E  GKWR+R  MAGF+  P+S  +  +++  L    +  + +++L+ +   L L  K +P
Sbjct:  439 DESVTVENHRDRLLRLVKHLSPNVVTLVEQEANTNTAPFLPRFVETMNHYLAVFESIDVKLARDHKERINVEQHCLAREVVNLIACEGVEREERHEPLGKWRSRFHMAGFKPYPLSSYVNATIKGLL----ESYSEKYTLEERDGALYLGWKNQP 589          
BLAST of EY684746 vs. ExPASy Swiss-Prot
Match: SCL13_ARATH (Scarecrow-like protein 13 OS=Arabidopsis thaliana GN=SCL13 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.587e-21
Identity = 52/99 (52.53%), Postives = 69/99 (69.70%), Query Frame = 3
Query:   15 DESVSTENPRDELLRRVKGLSPSVVTLVEQETNTNTAPFMARVNEACAYYGALFDSIESTVLRDHSDRVKVEEG-LSRKLANSVACEGRDRVERCEVFG 308
            DESVS EN RD LL  +K LSP +VTLVEQE+NTNT+PF++R  E   YY A+F+SI++   RD   R+  E+  ++R + N +ACE  +RVER EV G
Sbjct:  184 DESVSVENHRDRLLHLIKSLSPKLVTLVEQESNTNTSPFLSRFVETLDYYTAMFESIDAARPRDDKQRISAEQHCVARDIVNMIACEESERVERHEVLG 282          
BLAST of EY684746 vs. ExPASy Swiss-Prot
Match: RGL2_ARATH (DELLA protein RGL2 OS=Arabidopsis thaliana GN=RGL2 PE=1 SV=2)

HSP 1 Score: 97.8265 bits (242), Expect = 8.836e-20
Identity = 50/100 (50.00%), Postives = 64/100 (64.00%), Query Frame = 3
Query:   45 DELLRRVKGLSPSVVTLVEQETNTNTAPFMARVNEACAYYGALFDSIESTVLRDHSDRVKVEEGLSRKLANSVACEGRDRVERCEVFGKWRARMRMAGFE 344
            ++LL  VK + PS+VT+VEQE N N   F+ R NEA  YY +LFDS+E +      DRV  E  L R++ N VA EG DRVER E   +WR RM+ AGF+
Sbjct:  396 EKLLNTVKAIKPSIVTVVEQEANHNGIVFLDRFNEALHYYSSLFDSLEDSYSLPSQDRVMSEVYLGRQILNVVAAEGSDRVERHETAAQWRIRMKSAGFD 495          
BLAST of EY684746 vs. ExPASy Swiss-Prot
Match: RGL3_ARATH (DELLA protein RGL3 OS=Arabidopsis thaliana GN=RGL3 PE=1 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 9.769e-19
Identity = 49/100 (49.00%), Postives = 63/100 (63.00%), Query Frame = 3
Query:   45 DELLRRVKGLSPSVVTLVEQETNTNTAPFMARVNEACAYYGALFDSIESTVLRDHSDRVKVEEGLSRKLANSVACEGRDRVERCEVFGKWRARMRMAGFE 344
            ++LL  VK + P +VT+VEQE N N   F+ R NEA  YY +LFDS+E  V+    DRV  E  L R++ N VA EG DR+ER E   +WR RM  AGF+
Sbjct:  367 EKLLATVKAVKPGLVTVVEQEANHNGDVFLDRFNEALHYYSSLFDSLEDGVVIPSQDRVMSEVYLGRQILNLVATEGSDRIERHETLAQWRKRMGSAGFD 466          
The following BLAST results are available for this feature:
BLAST of EY684746 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 33
Match NameE-valueIdentityDescription
SCL8_ARATH1.183e-4869.29Scarecrow-like protein 8 OS=Arabidopsis thaliana G... [more]
PAT1_ARATH2.395e-3357.03Scarecrow-like transcription factor PAT1 OS=Arabid... [more]
SCL21_ARATH2.028e-3253.91Scarecrow-like protein 21 OS=Arabidopsis thaliana ... [more]
CIGR2_ORYSJ1.006e-3147.10Chitin-inducible gibberellin-responsive protein 2 ... [more]
CIGR1_ORYSJ1.006e-3151.97Chitin-inducible gibberellin-responsive protein 1 ... [more]
SCL1_ARATH2.928e-3152.34Scarecrow-like protein 1 OS=Arabidopsis thaliana G... [more]
SCL5_ARATH1.113e-3046.45Scarecrow-like protein 5 OS=Arabidopsis thaliana G... [more]
SCL13_ARATH3.587e-2152.53Scarecrow-like protein 13 OS=Arabidopsis thaliana ... [more]
RGL2_ARATH8.836e-2050.00DELLA protein RGL2 OS=Arabidopsis thaliana GN=RGL2... [more]
RGL3_ARATH9.769e-1949.00DELLA protein RGL3 OS=Arabidopsis thaliana GN=RGL3... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange bark, greenhouse plantcdna_library
Properties
Property NameValue
Genbank descriptionCS00-C2-003-003-B06-CT.F Sweet orange bark, greenhouse plant Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY684746 ID=EY684746|Name=EY684746|organism=Citrus sinensis|type=EST|length=904bp
CGGACGCGTGGGCGGACGAGAGCGTGTCAACGGAGAATCCGAGGGACGAG
CTGCTCCGGCGTGTAAAGGGGTTGTCACCGAGTGTGGTAACGTTGGTGGA
GCAAGAAACGAACACAAATACGGCGCCGTTCATGGCGCGCGTCAACGAGG
CGTGTGCATATTACGGAGCGTTGTTTGACTCGATCGAGTCGACCGTGCTG
AGAGACCACTCGGACCGAGTCAAAGTCGAGGAAGGGCTGAGTCGTAAATT
GGCTAACTCGGTTGCTTGTGAAGGCAGGGACCGTGTGGAGAGATGCGAGG
TGTTTGGCAAGTGGCGAGCCCGCATGAGGATGGCTGGGTTCGAGTTGAAG
CCAATGAGTCAAATCATTGCCGAGTCAATGCGGAATCGACTGAGGTGGGG
GGGGAAGCGAAAGACCCCCAGGTTCAGCCTCCAAACCAAAACCGACCCCT
TGGCTCTAGCTAGAAAGCAAAAACCCTCACGACACTGACCGGACCACAAG
AAAATAGACCCGCAAGAGCAAAAAGAATGACCTACGCGAGCCGGGGTGGC
AGCACGGACGCGAGTGCACAACCACGACACCACCGGAACGCCACGGACAC
AGAAAGGGACCCCGGAAAAAAACAACACGCGACACAACCCCACGGAGAGA
AAGCGAGAGGGCGGAAAAAACACAGACCCCCTACCAGAGCCACAAACAAA
GGAAACCACCCACACACAAAGATCACGAGGCACAGACACGCAGGCGGCAG
CGTGCAGAAACACGGAGCTTGAGACAACAAGAGAGAGCAGAAAAACGGGT
GAAGAGAAACAGAAGCGGCCAATAAACAACAAAAAAAAGAACGAAAGCAA
CAGATCAGAGAAAGGACGCAACGAGACGCAACAAAGGGGGAGAAGAAGTA
ACAC
back to top