EY684524

Overview
NameEY684524
Unique NameEY684524
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length957
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2682 contig Csv1_Contig2682:120..1076. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY684524 vs. ExPASy Swiss-Prot
Match: SMU1_RAT (WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 6.858e-50
Identity = 87/138 (63.04%), Postives = 109/138 (78.99%), Query Frame = 1
Query:   19 WDLKSTDCLQTFKPPPPLRGGDASVNSVHLFPKNPDHIVVCNKTSSIYIMTLQGQVVKSFSSGKREGGDFVAACVSPKGEWIYCVGEDRNLYCFSHQSGKLEHLMKVHEKDVIGVTHHPHRNLLATYGEDCTMKLWKP 432
            W++K+T+C  TFK      G D +VNSV L PKNP+H VVCN+++++ IM +QGQ+V+SFSSGKREGGDFV   +SP+GEWIYCVGED  LYCFS  +GKLE  + VHEKDVIG+ HHPH+NL+ATY ED  +KLWKP
Sbjct:  376 WNMKTTECSNTFKSLGSTAGTDITVNSVILLPKNPEHFVVCNRSNTVVIMNMQGQIVRSFSSGKREGGDFVCCALSPRGEWIYCVGEDFVLYCFSTVTGKLERTLTVHEKDVIGIAHHPHQNLIATYSEDGLLKLWKP 513          
BLAST of EY684524 vs. ExPASy Swiss-Prot
Match: SMU1_MOUSE (WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2)

HSP 1 Score: 197.978 bits (502), Expect = 6.858e-50
Identity = 87/138 (63.04%), Postives = 109/138 (78.99%), Query Frame = 1
Query:   19 WDLKSTDCLQTFKPPPPLRGGDASVNSVHLFPKNPDHIVVCNKTSSIYIMTLQGQVVKSFSSGKREGGDFVAACVSPKGEWIYCVGEDRNLYCFSHQSGKLEHLMKVHEKDVIGVTHHPHRNLLATYGEDCTMKLWKP 432
            W++K+T+C  TFK      G D +VNSV L PKNP+H VVCN+++++ IM +QGQ+V+SFSSGKREGGDFV   +SP+GEWIYCVGED  LYCFS  +GKLE  + VHEKDVIG+ HHPH+NL+ATY ED  +KLWKP
Sbjct:  376 WNMKTTECSNTFKSLGSTAGTDITVNSVILLPKNPEHFVVCNRSNTVVIMNMQGQIVRSFSSGKREGGDFVCCALSPRGEWIYCVGEDFVLYCFSTVTGKLERTLTVHEKDVIGIAHHPHQNLIATYSEDGLLKLWKP 513          
BLAST of EY684524 vs. ExPASy Swiss-Prot
Match: SMU1_HUMAN (WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2)

HSP 1 Score: 197.978 bits (502), Expect = 6.858e-50
Identity = 87/138 (63.04%), Postives = 109/138 (78.99%), Query Frame = 1
Query:   19 WDLKSTDCLQTFKPPPPLRGGDASVNSVHLFPKNPDHIVVCNKTSSIYIMTLQGQVVKSFSSGKREGGDFVAACVSPKGEWIYCVGEDRNLYCFSHQSGKLEHLMKVHEKDVIGVTHHPHRNLLATYGEDCTMKLWKP 432
            W++K+T+C  TFK      G D +VNSV L PKNP+H VVCN+++++ IM +QGQ+V+SFSSGKREGGDFV   +SP+GEWIYCVGED  LYCFS  +GKLE  + VHEKDVIG+ HHPH+NL+ATY ED  +KLWKP
Sbjct:  376 WNMKTTECSNTFKSLGSTAGTDITVNSVILLPKNPEHFVVCNRSNTVVIMNMQGQIVRSFSSGKREGGDFVCCALSPRGEWIYCVGEDFVLYCFSTVTGKLERTLTVHEKDVIGIAHHPHQNLIATYSEDGLLKLWKP 513          
BLAST of EY684524 vs. ExPASy Swiss-Prot
Match: SMU1_CRIGR (WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 6.858e-50
Identity = 87/138 (63.04%), Postives = 109/138 (78.99%), Query Frame = 1
Query:   19 WDLKSTDCLQTFKPPPPLRGGDASVNSVHLFPKNPDHIVVCNKTSSIYIMTLQGQVVKSFSSGKREGGDFVAACVSPKGEWIYCVGEDRNLYCFSHQSGKLEHLMKVHEKDVIGVTHHPHRNLLATYGEDCTMKLWKP 432
            W++K+T+C  TFK      G D +VNSV L PKNP+H VVCN+++++ IM +QGQ+V+SFSSGKREGGDFV   +SP+GEWIYCVGED  LYCFS  +GKLE  + VHEKDVIG+ HHPH+NL+ATY ED  +KLWKP
Sbjct:  376 WNMKTTECSNTFKSLGSTAGTDITVNSVILLPKNPEHFVVCNRSNTVVIMNMQGQIVRSFSSGKREGGDFVCCALSPRGEWIYCVGEDFVLYCFSTVTGKLERTLTVHEKDVIGIAHHPHQNLIATYSEDGLLKLWKP 513          
BLAST of EY684524 vs. ExPASy Swiss-Prot
Match: SMU1_BOVIN (WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 6.858e-50
Identity = 87/138 (63.04%), Postives = 109/138 (78.99%), Query Frame = 1
Query:   19 WDLKSTDCLQTFKPPPPLRGGDASVNSVHLFPKNPDHIVVCNKTSSIYIMTLQGQVVKSFSSGKREGGDFVAACVSPKGEWIYCVGEDRNLYCFSHQSGKLEHLMKVHEKDVIGVTHHPHRNLLATYGEDCTMKLWKP 432
            W++K+T+C  TFK      G D +VNSV L PKNP+H VVCN+++++ IM +QGQ+V+SFSSGKREGGDFV   +SP+GEWIYCVGED  LYCFS  +GKLE  + VHEKDVIG+ HHPH+NL+ATY ED  +KLWKP
Sbjct:  376 WNMKTTECSNTFKSLGSTAGTDITVNSVILLPKNPEHFVVCNRSNTVVIMNMQGQIVRSFSSGKREGGDFVCCALSPRGEWIYCVGEDFVLYCFSTVTGKLERTLTVHEKDVIGIAHHPHQNLIATYSEDGLLKLWKP 513          
BLAST of EY684524 vs. ExPASy Swiss-Prot
Match: SMU1_CHICK (WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 8.957e-50
Identity = 87/138 (63.04%), Postives = 109/138 (78.99%), Query Frame = 1
Query:   19 WDLKSTDCLQTFKPPPPLRGGDASVNSVHLFPKNPDHIVVCNKTSSIYIMTLQGQVVKSFSSGKREGGDFVAACVSPKGEWIYCVGEDRNLYCFSHQSGKLEHLMKVHEKDVIGVTHHPHRNLLATYGEDCTMKLWKP 432
            W++K+T+C  TFK      G D +VNSV L PKNP+H VVCN+++++ IM +QGQ+V+SFSSGKREGGDFV   +SP+GEWIYCVGED  LYCFS  +GKLE  + VHEKDVIG+ HHPH+NL+ATY ED  +KLWKP
Sbjct:  376 WNVKTTECSNTFKSLGSTAGTDITVNSVILLPKNPEHFVVCNRSNTVVIMNMQGQIVRSFSSGKREGGDFVCCALSPRGEWIYCVGEDFVLYCFSTVTGKLERTLTVHEKDVIGIAHHPHQNLIATYSEDGLLKLWKP 513          
BLAST of EY684524 vs. ExPASy Swiss-Prot
Match: SMU1_XENTR (WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 2.606e-49
Identity = 86/138 (62.32%), Postives = 108/138 (78.26%), Query Frame = 1
Query:   19 WDLKSTDCLQTFKPPPPLRGGDASVNSVHLFPKNPDHIVVCNKTSSIYIMTLQGQVVKSFSSGKREGGDFVAACVSPKGEWIYCVGEDRNLYCFSHQSGKLEHLMKVHEKDVIGVTHHPHRNLLATYGEDCTMKLWKP 432
            W++K+T+C  TFK      G D +VNSV L PKNP+H VVCN+++++ IM +QGQ+V+SFSSGKREGGDFV   +SP+GEWIYCVGED  LYCFS  +GKLE  + VHEKDVIG+ HHPH+NL+ TY ED  +KLWKP
Sbjct:  376 WNMKTTECSNTFKSLGSTAGTDITVNSVILLPKNPEHFVVCNRSNTVVIMNMQGQIVRSFSSGKREGGDFVCCTLSPRGEWIYCVGEDFVLYCFSTVTGKLERTLTVHEKDVIGIAHHPHQNLIGTYSEDGLLKLWKP 513          
BLAST of EY684524 vs. ExPASy Swiss-Prot
Match: SMU1_XENLA (WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 2.606e-49
Identity = 86/138 (62.32%), Postives = 108/138 (78.26%), Query Frame = 1
Query:   19 WDLKSTDCLQTFKPPPPLRGGDASVNSVHLFPKNPDHIVVCNKTSSIYIMTLQGQVVKSFSSGKREGGDFVAACVSPKGEWIYCVGEDRNLYCFSHQSGKLEHLMKVHEKDVIGVTHHPHRNLLATYGEDCTMKLWKP 432
            W++K+T+C  TFK      G D +VNSV L PKNP+H VVCN+++++ IM +QGQ+V+SFSSGKREGGDFV   +SP+GEWIYCVGED  LYCFS  +GKLE  + VHEKDVIG+ HHPH+NL+ TY ED  +KLWKP
Sbjct:  376 WNMKTTECSNTFKSLGSTAGTDITVNSVILLPKNPEHFVVCNRSNTVVIMNMQGQIVRSFSSGKREGGDFVCCTLSPRGEWIYCVGEDFVLYCFSTVTGKLERTLTVHEKDVIGIAHHPHQNLIGTYSEDGLLKLWKP 513          
BLAST of EY684524 vs. ExPASy Swiss-Prot
Match: SMU1_DANRE (WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 4.445e-49
Identity = 85/138 (61.59%), Postives = 108/138 (78.26%), Query Frame = 1
Query:   19 WDLKSTDCLQTFKPPPPLRGGDASVNSVHLFPKNPDHIVVCNKTSSIYIMTLQGQVVKSFSSGKREGGDFVAACVSPKGEWIYCVGEDRNLYCFSHQSGKLEHLMKVHEKDVIGVTHHPHRNLLATYGEDCTMKLWKP 432
            W++K+T+C  TFK      G D +VN+V L PKNP+H VVCN+++++ IM +QGQ+V+SFSSGKREGGDFV   +SP+GEWIYCVGED  LYCFS  +GKLE  + VHEKDVIG+ HHPH+NL+ TY ED  +KLWKP
Sbjct:  376 WNMKTTECTSTFKSLGTSAGTDITVNNVILLPKNPEHFVVCNRSNTVVIMNMQGQIVRSFSSGKREGGDFVCCTLSPRGEWIYCVGEDYVLYCFSTVTGKLERTLTVHEKDVIGIAHHPHQNLIGTYSEDGLLKLWKP 513          
BLAST of EY684524 vs. ExPASy Swiss-Prot
Match: SMU1_DICDI (WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2)

HSP 1 Score: 117.472 bits (293), Expect = 1.178e-25
Identity = 57/138 (41.30%), Postives = 88/138 (63.77%), Query Frame = 1
Query:   19 WDLKSTDCLQTFKPPPPLRGGDASVNSVHLFPKNPDHIVVCNKTSSIYIMTLQGQVV-KSFSSGKREGGDFVAACVSPKGEWIYCVGEDRNLYCFSHQSGKLEHLMKVHEKDVIGVTHHPHRNLLATYGEDCTMKLWK 429
            WD KS+DCLQT  P   +   D S+ S+ +  KNP+ ++VCN +S I I++++ Q + K+F+S   +   F+   +SP   ++Y V ED  LY F   SG L +  K+H+++VI ++HHP +NLLAT G DC +K+WK
Sbjct:  387 WDAKSSDCLQTITPTSVVTVRDISIRSITILLKNPEFLLVCN-SSQISIVSMKSQTISKTFTSENSK--TFLVCTLSPLQNYLYAVDEDNILYTFDFNSGSLLNKFKIHDQEVISISHHPTKNLLATTGSDCLLKIWK 521          
The following BLAST results are available for this feature:
BLAST of EY684524 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
SMU1_RAT6.858e-5063.04WD40 repeat-containing protein SMU1 OS=Rattus norv... [more]
SMU1_MOUSE6.858e-5063.04WD40 repeat-containing protein SMU1 OS=Mus musculu... [more]
SMU1_HUMAN6.858e-5063.04WD40 repeat-containing protein SMU1 OS=Homo sapien... [more]
SMU1_CRIGR6.858e-5063.04WD40 repeat-containing protein SMU1 OS=Cricetulus ... [more]
SMU1_BOVIN6.858e-5063.04WD40 repeat-containing protein SMU1 OS=Bos taurus ... [more]
SMU1_CHICK8.957e-5063.04WD40 repeat-containing protein SMU1 OS=Gallus gall... [more]
SMU1_XENTR2.606e-4962.32WD40 repeat-containing protein SMU1 OS=Xenopus tro... [more]
SMU1_XENLA2.606e-4962.32WD40 repeat-containing protein SMU1 OS=Xenopus lae... [more]
SMU1_DANRE4.445e-4961.59WD40 repeat-containing protein SMU1 OS=Danio rerio... [more]
SMU1_DICDI1.178e-2541.30WD40 repeat-containing protein smu1 OS=Dictyosteli... [more]
back to top
Libraries
Library NameType
Sweet orange bark, greenhouse plantcdna_library
Properties
Property NameValue
Genbank descriptionCS00-C2-003-001-B01-CT.F Sweet orange bark, greenhouse plant Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY684524 ID=EY684524|Name=EY684524|organism=Citrus sinensis|type=EST|length=957bp
TCCCGACCCACGCGTCCGTGGGACCTGAAGAGTACTGATTGCCTCCAGAC
ATTTAAGCCACCACCTCCTTTGAGGGGAGGTGATGCTTCAGTGAACTCTG
TCCATTTATTCCCAAAGAATCCCGATCACATAGTCGTATGTAATAAGACA
TCCTCAATATACATAATGACTCTTCAAGGACAGGTTGTGAAGAGTTTTTC
TTCTGGTAAAAGAGAAGGTGGAGATTTTGTTGCTGCTTGTGTTTCACCGA
AAGGTGAATGGATCTATTGTGTTGGTGAAGACAGGAACTTGTACTGCTTC
AGCCATCAGTCTGGTAAACTAGAGCATCTAATGAAGGTCCATGAAAAGGA
TGTAATTGGTGTGACTCATCATCCCCATAGAAACCTTCTGGCAACATATG
GTGAAGATTGCACAATGAAATTATGGAAGCCTTGATTCCCTGTATTTGCT
TCCGTTGAAATGAAAAATGTTTCTGTAATTTCTTGGAATGTTGTCTTCAT
TCATTAGACCCATTATTCACTGGGGGGACATGGGTTGGGAAGAGGCAAAT
ATCAATCACAGATCACGGGCTCTCCTCTTGAATGATATGTTGGCCAGCAG
GGGGGGAGGACTTTGCGGAACATGGCACGCTTGAGAGCGGGAGCGCGGGA
GAGCGGACGAGGGGGCGGCGAGTGGGCGAAACGGACGGTGGAAACCTCGA
AACACGACAAGGACGGGCCGAGACACAGGGAGGAACACCACGCGGAGAGA
GGGCGGGGGGGAGGGCGGACGCACACACAGGCCCGGAGGGGCCGACGAGA
GGGCGCGAGGGGGAGGAGGGCAGAGCAAAAGGAGAGAGGCAAAATGCGCC
GCGCGCGGGACGGGGCAACAGGCAAGGCNGCAGAGAGAGACGACGGAGCA
GGACCAGGCGGGAGACACAACGAGACGGAACAACCCCACCGGACAAAACG
CAACCGA
back to top