EY660295

Overview
NameEY660295
Unique NameEY660295
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length897
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7550 contig Csv1_Contig7550:1..898. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY660295 vs. ExPASy Swiss-Prot
Match: PME54_ARATH (Probable pectinesterase/pectinesterase inhibitor 54 OS=Arabidopsis thaliana GN=PME54 PE=2 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 2.885e-63
Identity = 136/276 (49.28%), Postives = 172/276 (62.32%), Query Frame = 1
Query:   37 KDFVNSLGLSERNEVTENI*KKMDYLSQLTSNPLALVNRIARASYPKNSTYNRRLDEEQGDFPNWVSAKNRKLLQAPRINANVIVAQDGTGNYRTVSEAISAASGNRFVIYVKAGVYKEKIRTNKDGITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDIGFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNAAARFQNCYLVLRRPEG--SYHAITANGKTDPGQNTASLFRTVKL 858
            KD +   G S       +I +KMD+LS+L SN L LV+ I +   PK  +            P WV+A  R+LL   R  A+V+VA+DG+G+YRTV EA++AA GN                           GK  T+I GDD+A  GTS+P TAT T+TGDGFIARDIG  N AGP+G QA+AL++ SD +V YRCSI+GYQDTLYA ALRQFYR+ DIYGTIDFIFGNAAA FQ+C + LRRP G  +Y+ I ANG+TD  QNT     + ++
Sbjct:  158 KDSILDSGGSSSASAISHISQKMDHLSRLVSNSLTLVDTIMKNPKPKTKSTA---------LPRWVTAGERRLLVG-RARAHVVVAKDGSGDYRTVMEAVTAAHGN---------------------------GKDLTVIVGDDSATGGTSVPDTATMTVTGDGFIARDIGIKNIAGPRGHQAIALSITSDQSVLYRCSISGYQDTLYAAALRQFYRECDIYGTIDFIFGNAAAVFQSCNIFLRRPHGVKAYNVILANGRTDQRQNTGFALHSCRI 396          
BLAST of EY660295 vs. ExPASy Swiss-Prot
Match: PME17_ARATH (Probable pectinesterase/pectinesterase inhibitor 17 OS=Arabidopsis thaliana GN=PME17 PE=2 SV=2)

HSP 1 Score: 229.565 bits (584), Expect = 1.935e-59
Identity = 126/257 (49.03%), Postives = 159/257 (61.87%), Query Frame = 1
Query:  106 DYLSQLTSNPLA--LVNRIARASYPKNSTYNRRLDEEQGDFPNWVSAKNRKLLQAPRINANVIVAQDGTGNYRTVSEAISAASGN-RFVIYVKAGVYKEKIRTNKDGITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDIGFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNAAARFQNCYLVLRRPEGSYHAITANGKTDPGQNTASLFRTVKLLRA 867
            D +  L SN ++  L N +A    P N T       E+  FP+WV   +RKLLQ+     N +VA+DG+GN++T+ EAI AASG+ RFVIYVK GVY E +   K  + L GDG   TIITG  +   GT+   +AT    GDGFIAR I F NTAG   EQA+AL   SD +VFY+CS   YQDTLY  + RQFYRD D+YGT+DFIFGNAAA  QNC +  RRP    + ITA G++DP QNT  +    ++  A
Sbjct:  151 DIVLPLMSNNVSNLLCNTLAINKVPFNYT-----PPEKDGFPSWVKPGDRKLLQSSTPKDNAVVAKDGSGNFKTIKEAIDAASGSGRFVIYVKQGVYSENLEIRKKNVMLRGDGIGKTIITGSKSVGGGTTTFNSATVAAVGDGFIARGITFRNTAGASNEQAVALRSGSDLSVFYQCSFEAYQDTLYVHSNRQFYRDCDVYGTVDFIFGNAAAVLQNCNIFARRPRSKTNTITAQGRSDPNQNTGIIIHNSRVTAA 402          
BLAST of EY660295 vs. ExPASy Swiss-Prot
Match: PME2_CITSI (Pectinesterase 2 OS=Citrus sinensis GN=PECS-2.1 PE=2 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 6.883e-57
Identity = 113/220 (51.36%), Postives = 143/220 (65.00%), Query Frame = 1
Query:  220 FPNWVSAKNRKLLQA-PRINANVIVAQDGTGNYRTVSEAISAAS---GNRFVIYVKAGVYKEKIRTNKDGITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDIGFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNAAARFQNCYLVLRRPEGSYHAITANGKTDPGQNTASLFRTVKLLRA 867
            FP WV   +RKLLQ  PR  AN++VAQDG+GN +T+ EA++AAS   G+R+VIY+KAG Y E I      I  +GDG   TIITG  +   G +   +AT  + GD FIARDI   NTAGP   QA+AL   SD +VFYRCS  GYQDTLY  + RQFYR+ DIYGT+DFIFGNAA   QNC +  R+P    + +TA G+TDP Q+T  +    ++  A
Sbjct:  183 FPTWVKPGDRKLLQTTPR--ANIVVAQDGSGNVKTIQEAVAAASRAGGSRYVIYIKAGTYNENIEVKLKNIMFVGDGIGKTIITGSKSVGGGATTFKSATVAVVGDNFIARDITIRNTAGPNNHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARKPPNRTNTLTAQGRTDPNQSTGIIIHNCRVTAA 400          
BLAST of EY660295 vs. ExPASy Swiss-Prot
Match: PME18_ARATH (Pectinesterase/pectinesterase inhibitor 18 OS=Arabidopsis thaliana GN=PME18 PE=1 SV=2)

HSP 1 Score: 212.231 bits (539), Expect = 3.802e-56
Identity = 115/223 (51.57%), Postives = 150/223 (67.26%), Query Frame = 1
Query:  220 FPNWVSAKNRKLLQAP----RINANVIVAQDGTGNYRTVSEAISAA---SGNRFVIYVKAGVYKEKIRTNKD--GITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDIGFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNAAARFQNCYLVLRRP-EGSYHAITANGKTDPGQNTASLFRTVKL 858
            FP+W++A +RKLL++     ++ ANV+VA+DGTG ++TV+EA++AA   S  R+VIYVK GVYKE I   K    + L+GDGK  TIITG  N   G++   +AT    GDGF+A+DI F NTAGP   QA+AL V++D TV  RC I  YQDTLY   LRQFYRD+ I GT+DFIFGN+A  FQNC +V R P  G  + +TA G+ D  QNTA   +  K+
Sbjct:  222 FPSWLTALDRKLLESSPKTLKVTANVVVAKDGTGKFKTVNEAVAAAPENSNTRYVIYVKKGVYKETIDIGKKKKNLMLVGDGKDATIITGSLNVIDGSTTFRSATVAANGDGFMAQDIWFQNTAGPAKHQAVALRVSADQTVINRCRIDAYQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARNPGAGQKNMLTAQGREDQNQNTAISIQKCKI 444          

HSP 2 Score: 27.7202 bits (60), Expect = 3.802e-56
Identity = 12/17 (70.59%), Postives = 12/17 (70.59%), Query Frame = 3
Query:  837 SFQNCKIAAGSDYAPVK 887
            S Q CKI A SD APVK
Sbjct:  438 SIQKCKITASSDLAPVK 454          
BLAST of EY660295 vs. ExPASy Swiss-Prot
Match: PME59_ARATH (Probable pectinesterase/pectinesterase inhibitor 59 OS=Arabidopsis thaliana GN=PME59 PE=2 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 9.939e-56
Identity = 125/263 (47.53%), Postives = 168/263 (63.88%), Query Frame = 1
Query:  112 LSQLTSNPLALVNRIARASYPKNSTYNRRLDEEQGDFPNWVSAKNRKLLQAPRINANVIVAQDGTGNYRTVSEAISAA-----SGNRFVIYVKAGVYKEKI--RTNKDGITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDIGFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNAAARFQNCYLVLRRP-EGSYHAITANGKTDPGQNTASLFRTVKLLRAPTM 876
            +S L SN LA+   +  A    N+T N++       FP W+S K+++LL+A R  AN++VA+DG+G++ TV  AI  A     +  RFVIYVK G+Y+E I  R N D I L+GDG  +TIITG  + + G +   +AT  I G  FIA+ I F NTAGP   QA+AL  +SD ++FY+CSI GYQDTL   + RQFYR+  IYGT+DFIFGNAAA FQNC ++ RRP +G  + ITA G+ DP QNT       ++L AP +
Sbjct:  173 ISHLISNCLAVNGALLTAGNKGNTTANQK------GFPTWLSRKDKRLLRAVR--ANLVVAKDGSGHFNTVQAAIDVAGRRKVTSGRFVIYVKRGIYQENINVRLNNDDIMLVGDGMRSTIITGGRSVQGGYTTYNSATAGIEGLHFIAKGITFRNTAGPAKGQAVALRSSSDLSIFYKCSIEGYQDTLMVHSQRQFYRECYIYGTVDFIFGNAAAVFQNCLILPRRPLKGQANVITAQGRADPFQNTGISIHNSRILPAPDL 427          
BLAST of EY660295 vs. ExPASy Swiss-Prot
Match: PME60_ARATH (Probable pectinesterase/pectinesterase inhibitor 60 OS=Arabidopsis thaliana GN=PME60 PE=2 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 3.197e-54
Identity = 121/263 (46.01%), Postives = 163/263 (61.98%), Query Frame = 1
Query:  112 LSQLTSNPLALVNRIARASYPKNSTYNRRLDEEQGDFPNWVSAKNRKLLQAPRINANVIVAQDGTGNYRTVSEAISAA-----SGNRFVIYVKAGVYKEK--IRTNKDGITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDIGFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNAAARFQNCYLVLRRP-EGSYHAITANGKTDPGQNTASLFRTVKLLRAPTM 876
            +S L SN LA+   +  A    ++T + +       FP WVS K R+LLQ   + AN++VA+DG+G+++TV  AI  A     +  RFVIYVK G+Y+E   +R N D I L+GDG   TIITG  + + G +  ++AT  I G  FIA+ I F NTAGP   QA+AL  +SD ++FYRCSI GYQDTL   + RQFYR+  IYGT+DFIFGNAA  FQNC ++ R P +G  + ITA G+TD  QNT        ++ AP +
Sbjct:  175 ISHLISNCLAVNGALLTAGKNDSTTGDSK------GFPTWVSRKERRLLQLQSVRANLVVAKDGSGHFKTVQAAIDVAGRRKVTSGRFVIYVKRGIYQENLNVRLNNDNIMLVGDGMRYTIITGGRSVKGGYTTYSSATAGIEGLHFIAKGIAFQNTAGPAKGQAVALRSSSDLSIFYRCSIEGYQDTLMVHSQRQFYRECYIYGTVDFIFGNAAVVFQNCIILPRLPLKGQANVITAQGRTDLFQNTGISIHNSIIIPAPDL 431          
BLAST of EY660295 vs. ExPASy Swiss-Prot
Match: PME35_ARATH (Probable pectinesterase/pectinesterase inhibitor 35 OS=Arabidopsis thaliana GN=PME35 PE=2 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 3.535e-53
Identity = 115/247 (46.56%), Postives = 161/247 (65.18%), Query Frame = 1
Query:  112 LSQLTSNPLAL-VNRIARASYPKNSTYNRRLDEEQGDFPNWVSAKNRKLLQAP--RINANVIVAQDGTGNYRTVSEAISAAS--GNRFVIYVKAGVYKEKIR--TNKDGITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDIGFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNAAARFQNCYLVLRRPEGSYHAITANGKTDPGQNT 831
            L+ L +N L + V+   ++S   N T  R+L  +  DFP WVS+ +RKLL+A    +  + +VA DG+G + +V+EA+++      R VI++ AG YKE +   + +  + L+GDGK  T+I G  + R G +   +AT    GDGFIARDI F N+AGP  EQA+AL V SD +V YRCSI GYQD+LY L+ RQFYR+TDI GT+DFIFGN+A  FQ+C LV R+     + +TA G++DP QNT
Sbjct:  170 LTGLLTNSLDMFVSDKQKSSSSSNLTGGRKLLSDH-DFPTWVSSSDRKLLEASVEELRPHAVVAADGSGTHMSVAEALASLEKGSGRSVIHLTAGTYKENLNIPSKQKNVMLVGDGKGKTVIVGSRSNRGGWNTYQSATVAAMGDGFIARDITFVNSAGPNSEQAVALRVGSDRSVVYRCSIDGYQDSLYTLSKRQFYRETDITGTVDFIFGNSAVVFQSCNLVSRKGSSDQNYVTAQGRSDPNQNT 415          
BLAST of EY660295 vs. ExPASy Swiss-Prot
Match: PME21_SOLLC (Pectinesterase 2.1 OS=Solanum lycopersicum GN=PME2.1 PE=2 SV=2)

HSP 1 Score: 208.764 bits (530), Expect = 3.535e-53
Identity = 119/264 (45.08%), Postives = 162/264 (61.36%), Query Frame = 1
Query:  112 LSQLTSNPLALVNRIARASYPKNSTYNRRLDEEQGDFPNWVSAKNRKLLQAPR--INANVIVAQDGTGNYRTVSEAISAA---SGNRFVIYVKAGVYKEKIRTN--KDGITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDIGFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNAAARFQNCYLVLRRPEGSY--HAITANGKTDPGQNTASLFRTVKLLRAPTM 876
            L +L S     +  +A  + P +      L    G  P+WVS+++RKL+++    I AN +VA+DGTG YRT++EA++AA   S  R+VIYVK G YKE +  +  K  + +IGDG Y TIITG  N   G++   +AT    G GFI +DI   NTAGP   QA+AL V +D +V  RC I  YQDTLYA + RQFYRD+ + GTIDFIFGNAA  FQ C LV R+P G Y  + +TA G+TDP Q T +  +   ++ +P +
Sbjct:  183 LDELISRAKVALAMLASVTTPNDEVLRPGL----GKMPSWVSSRDRKLMESSGKDIGANAVVAKDGTGKYRTLAEAVAAAPDKSKTRYVIYVKRGTYKENVEVSSRKMNLMIIGDGMYATIITGSLNVVDGSTTFHSATLAAVGKGFILQDICIQNTAGPAKHQAVALRVGADKSVINRCRIDAYQDTLYAHSQRQFYRDSYVTGTIDFIFGNAAVVFQKCQLVARKP-GKYQQNMVTAQGRTDPNQATGTSIQFCDIIASPDL 441          
BLAST of EY660295 vs. ExPASy Swiss-Prot
Match: PME61_ARATH (Probable pectinesterase/pectinesterase inhibitor 61 OS=Arabidopsis thaliana GN=PME61 PE=1 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 1.343e-52
Identity = 120/278 (43.17%), Postives = 161/278 (57.91%), Query Frame = 1
Query:   76 EVTENI*KKMDYLSQLTSNPLALVNRIARASYPKNSTYNRRL--DEEQGDFPNWVSAKNRKLLQAPR--INANVIVAQDGTGNYRTVSEAISAA---SGNRFVIYVKAGVYKE---KIRTNKDGITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDIGFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNAAARFQNCYLVLRRPEGSYH-AITANGKTDPGQNTASLFRTVKLLRAPTM 876
            EV + +   +  LS++ SN LA+     +         NR+L   EE  + PNW+  ++R+LL  P   I A++ V++DG+G ++T++EAI  A   S  RFVIYVKAG Y+E   K+   K  +  IGDGK  T+ITG  +     +   TATF  TG GFI RD+ F N AGP   QA+AL V  DH V YRC+I GYQD LY  + RQF+R+ +IYGT+DFIFGNAA   Q+C +  R+P       ITA  + DP QNT       KLL  P +
Sbjct:  201 EVKDQVIGAVKDLSEMVSNCLAIFAGKVKDLSGVPVVNNRKLLGTEETEELPNWLKREDRELLGTPTSAIQADITVSKDGSGTFKTIAEAIKKAPEHSSRRFVIYVKAGRYEEENLKVGRKKTNLMFIGDGKGKTVITGGKSIADDLTTFHTATFAATGAGFIVRDMTFENYAGPAKHQAVALRVGGDHAVVYRCNIIGYQDALYVHSNRQFFRECEIYGTVDFIFGNAAVILQSCNIYARKPMAQQKITITAQNRKDPNQNTGISIHACKLLATPDL 478          
BLAST of EY660295 vs. ExPASy Swiss-Prot
Match: PME22_ARATH (Putative pectinesterase/pectinesterase inhibitor 22 OS=Arabidopsis thaliana GN=PME22 PE=3 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 1.343e-52
Identity = 125/266 (46.99%), Postives = 162/266 (60.90%), Query Frame = 1
Query:  112 LSQLTSNPLALVNRIARASYPKNSTYNRRLDEEQGDFPNWVSAKNRKLLQA--PRI-NANVIVAQDGTGNYRTVSEAISAA---SGNRFVIYVKAGVYKEKI--RTNKDGITLIGDGKYTTIITGDDNARRGTSMPATATFTITGDGFIARDIGFHNTAGPQGEQALALNVASDHTVFYRCSIAGYQDTLYALALRQFYRDTDIYGTIDFIFGNAAARFQNCYLVLRRPEGSYH-AITANGKTDPGQNTASLFRTVKLLRA-PTML 879
            ++QL SN L +  ++   + P  ++ N  +       P W++  +  L+    P + + N +VA DG G YRT++EAI+ A   S  R+VIYVK GVYKE I  +  K  I L+GDG   TIITGD N  +G +   TAT  ++G GFIA+DI F NTAGPQ  QA+AL V SD + FYRCS+ GYQDTLYA +LRQFYRD +IYGTIDFIFGN AA  QNC +  R P       ITA G+  P QNT  + +   +L   PT L
Sbjct:  187 VTQLVSNVLDMYTQLN--ALPFKASRNESVIAS----PEWLTETDESLMMRHDPSVMHPNTVVAIDGKGKYRTINEAINEAPNHSTKRYVIYVKKGVYKENIDLKKKKTNIMLVGDGIGQTIITGDRNFMQGLTTFRTATVAVSGRGFIAKDITFRNTAGPQNRQAVALRVDSDQSAFYRCSVEGYQDTLYAHSLRQFYRDCEIYGTIDFIFGNGAAVLQNCKIYTRVPLPLQKVTITAQGRKSPNQNTGFVIQNSYVLATQPTYL 446          
The following BLAST results are available for this feature:
BLAST of EY660295 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 88
Match NameE-valueIdentityDescription
PME54_ARATH2.885e-6349.28Probable pectinesterase/pectinesterase inhibitor 5... [more]
PME17_ARATH1.935e-5949.03Probable pectinesterase/pectinesterase inhibitor 1... [more]
PME2_CITSI6.883e-5751.36Pectinesterase 2 OS=Citrus sinensis GN=PECS-2.1 PE... [more]
PME18_ARATH3.802e-5651.57Pectinesterase/pectinesterase inhibitor 18 OS=Arab... [more]
PME59_ARATH9.939e-5647.53Probable pectinesterase/pectinesterase inhibitor 5... [more]
PME60_ARATH3.197e-5446.01Probable pectinesterase/pectinesterase inhibitor 6... [more]
PME35_ARATH3.535e-5346.56Probable pectinesterase/pectinesterase inhibitor 3... [more]
PME21_SOLLC3.535e-5345.08Pectinesterase 2.1 OS=Solanum lycopersicum GN=PME2... [more]
PME61_ARATH1.343e-5243.17Probable pectinesterase/pectinesterase inhibitor 6... [more]
PME22_ARATH1.343e-5246.99Putative pectinesterase/pectinesterase inhibitor 2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-020-F08-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY660295 ID=EY660295; Name=EY660295; organism=Citrus sinensis; type=EST; length=897bp
TTCAAACAAGGACGTGTCCGCTTTCCATTTCCCTAAAAAGACTTTGTGAA
TAGCCTCGGTCTCTCAGAGAGAAATGAGGTTACTGAAAACATATAAAAAA
AAATGGATTATTTGTCTCAACTGACCAGTAATCCTTTAGCCCTTGTCAAC
AGGATAGCCAGGGCTAGTTACCCAAAGAACAGCACATATAATCGGCGTCT
AGATGAGGAACAAGGTGATTTTCCCAACTGGGTATCGGCGAAAAATAGGA
AACTGCTGCAGGCCCCGCGCATAAATGCAAATGTGATTGTGGCTCAAGAT
GGAACTGGCAATTATAGAACTGTTTCGGAAGCTATCAGTGCTGCTTCTGG
AAATCGTTTTGTGATTTATGTGAAGGCAGGTGTTTATAAGGAGAAAATTC
GAACTAACAAGGACGGTATTACTTTGATAGGAGATGGCAAATACACTACT
ATTATTACTGGTGATGATAATGCTCGTAGAGGCACTTCCATGCCTGCAAC
CGCCACTTTCACAATCACAGGTGATGGATTTATCGCACGAGATATCGGAT
TTCATAACACAGCAGGACCCCAAGGAGAGCAAGCATTAGCTCTAAACGTA
GCCTCAGATCATACGGTCTTTTACAGGTGCAGCATTGCAGGCTACCAAGA
CACACTGTACGCCCTCGCTCTGCGTCAGTTCTACAGAGACACCGACATCT
ACGGGACCATCGACTTCATATTCGGAAACGCAGCCGCCCGTTTCCAGAAC
TGTTACCTGGTCCTTCGCCGCCCCGAAGGGAGCTACCATGCTATTACTGC
AAACGGGAAGACAGACCCTGGACAAAACACGGCTTCTCTTTTCAGAACTG
TAAAATTGCTGCGGGCTCCGACTATGCTCCAGTGAAAATAAATATAA
back to top