EY660170

Overview
NameEY660170
Unique NameEY660170
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length888
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY660170 vs. ExPASy Swiss-Prot
Match: PEL1_ARATH (Probable pectate lyase 1 OS=Arabidopsis thaliana GN=At1g04680 PE=2 SV=2)

HSP 1 Score: 202.601 bits (514), Expect = 2.478e-51
Identity = 97/127 (76.38%), Postives = 99/127 (77.95%), Query Frame = 3
Query:   12 LIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRYNAPLNAFAKEVTKRVDTAASQWKGWNWRSEGDLLLNGAYFTPXXXXXXXXXXXXXXXXXKSSSMVGSITSGAGALTCRKSRQCS 392
            LIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRY AP N FAKEVTKRVDT AS WKGWNWRSEGDLL NGAYFT                  KSSS+VG ITS AGAL CR+ RQCS
Sbjct:  304 LIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRYAAPKNPFAKEVTKRVDTPASHWKGWNWRSEGDLLQNGAYFTSSGAAASGSYARASSLSAKSSSLVGHITSDAGALPCRRGRQCS 430          
BLAST of EY660170 vs. ExPASy Swiss-Prot
Match: PEL15_ARATH (Probable pectate lyase 15 OS=Arabidopsis thaliana GN=At4g13710 PE=2 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 9.744e-48
Identity = 90/126 (71.43%), Postives = 97/126 (76.98%), Query Frame = 3
Query:   12 LIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRYNAPLNAFAKEVTKRVDTAASQWKGWNWRSEGDLLLNGAYFTPXXXXXXXXXXXXXXXXXKSSSMVGSITSGAGALTCRKSRQC 389
            L+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQGNRY AP++ FAKEVTKRV+T AS+WK WNWRSEGDLLLNGA+F P                 K SSMV +ITS AGAL CRK R C
Sbjct:  345 LVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYAAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAFFRPSGAGASASYGRASSLAAKPSSMVDTITSTAGALGCRKGRPC 470          
BLAST of EY660170 vs. ExPASy Swiss-Prot
Match: PEL8_ARATH (Probable pectate lyase 8 OS=Arabidopsis thaliana GN=At3g07010 PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 3.466e-45
Identity = 86/126 (68.25%), Postives = 95/126 (75.40%), Query Frame = 3
Query:   12 LIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRYNAPLNAFAKEVTKRVDTAASQWKGWNWRSEGDLLLNGAYFTPXXXXXXXXXXXXXXXXXKSSSMVGSITSGAGALTCRKSRQC 389
            LIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQGNR+ AP+N FAKEVTKR  T  S+WK WNWRSEGDL LNGA+FT                  KSSS+VG++TS +GAL CR  R+C
Sbjct:  291 LIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAGPTINSQGNRFLAPVNPFAKEVTKREYTGESKWKHWNWRSEGDLFLNGAFFTRSGAGAGANYARASSLSAKSSSLVGTMTSYSGALNCRAGRRC 416          
BLAST of EY660170 vs. ExPASy Swiss-Prot
Match: PEL14_ARATH (Putative pectate lyase 14 OS=Arabidopsis thaliana GN=At4g13210 PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 2.934e-44
Identity = 84/126 (66.67%), Postives = 91/126 (72.22%), Query Frame = 3
Query:   12 LIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRYNAPLNAFAKEVTKRVDTAASQWKGWNWRSEGDLLLNGAYFTPXXXXXXXXXXXXXXXXXKSSSMVGSITSGAGALTCRKSRQC 389
            LIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNR+ AP N FAKEVTKRV     +W  WNWRS+GDL+LNGAYFT                  KSSS+VG +TS +GAL CR    C
Sbjct:  293 LIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFLAPGNRFAKEVTKRVGAGKGEWNNWNWRSQGDLMLNGAYFTSSGAGASANYARASSLAAKSSSLVGMLTSSSGALKCRIGTLC 418          
BLAST of EY660170 vs. ExPASy Swiss-Prot
Match: PEL18_ARATH (Probable pectate lyase 18 OS=Arabidopsis thaliana GN=At4g24780 PE=2 SV=2)

HSP 1 Score: 178.718 bits (452), Expect = 3.832e-44
Identity = 83/126 (65.87%), Postives = 92/126 (73.02%), Query Frame = 3
Query:   12 LIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRYNAPLNAFAKEVTKRVDTAASQWKGWNWRSEGDLLLNGAYFTPXXXXXXXXXXXXXXXXXKSSSMVGSITSGAGALTCRKSRQC 389
            L+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNR+ AP   F+KEVTK  D   S+WK WNWRS GDLLLNGA+FTP                 K SS+VG +TS +GAL CRK  +C
Sbjct:  283 LVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFLAPNIRFSKEVTKHEDAPESEWKRWNWRSSGDLLLNGAFFTPSGGAASSSYAKASSLGAKPSSLVGPLTSTSGALNCRKGSRC 408          
BLAST of EY660170 vs. ExPASy Swiss-Prot
Match: PEL20_ARATH (Probable pectate lyase 20 OS=Arabidopsis thaliana GN=At5g48900 PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 6.536e-44
Identity = 86/126 (68.25%), Postives = 91/126 (72.22%), Query Frame = 3
Query:   12 LIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRYNAPLNAFAKEVTKRVDTAASQWKGWNWRSEGDLLLNGAYFTPXXXXXXXXXXXXXXXXXKSSSMVGSITSGAGALTCRKSRQC 389
            LIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRY AP N FAKEVTKR      QW+ WNWRSEGDL LNGA+FT                  KSSS+VG IT  AGAL CR  R+C
Sbjct:  292 LIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGNRYLAPRNRFAKEVTKRDYAGQWQWRHWNWRSEGDLFLNGAFFTRSGSGLGASYARASSLAAKSSSLVGVITYNAGALNCRGGRRC 417          
BLAST of EY660170 vs. ExPASy Swiss-Prot
Match: PEL9_ARATH (Probable pectate lyase 9 OS=Arabidopsis thaliana GN=At3g24230 PE=2 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 9.438e-43
Identity = 82/126 (65.08%), Postives = 95/126 (75.40%), Query Frame = 3
Query:   12 LIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRYNAPLNAFAKEVTKRVDTAASQWKGWNWRSEGDLLLNGAYFTPXXXXXXXXXXXXXXXXXKSSSMVGSITSGAGALTCRKSRQC 389
            LIQRMPRCRHGYFHVVNNDYTHW+MYAIGGSANPTINSQGNR+ AP N  AKEVTKR+DT  ++W  WNWRSE DLL+NGA+FTP                 K +SMV +IT+ AGAL+CR+ + C
Sbjct:  327 LIQRMPRCRHGYFHVVNNDYTHWKMYAIGGSANPTINSQGNRFAAPKNHSAKEVTKRLDTKGNEWMEWNWRSEKDLLVNGAFFTP-SGEGASGDSQTLSLPAKPASMVDAITASAGALSCRRGKPC 451          
BLAST of EY660170 vs. ExPASy Swiss-Prot
Match: PEL11_ARATH (Putative pectate lyase 11 OS=Arabidopsis thaliana GN=At3g27400 PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 6.117e-42
Identity = 79/126 (62.70%), Postives = 91/126 (72.22%), Query Frame = 3
Query:   12 LIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRYNAPLNAFAKEVTKRVDTAASQWKGWNWRSEGDLLLNGAYFTPXXXXXXXXXXXXXXXXXKSSSMVGSITSGAGALTCRKSRQC 389
            L+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTI SQGNR+ AP   F KEVTK  D   S+W+ WNWRSEGD+LLNGAYF                   + SS+VGSIT+ AG L+CR+ R+C
Sbjct:  284 LVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTIYSQGNRFLAPNTRFNKEVTKHEDAPESKWRDWNWRSEGDMLLNGAYFRESGAEAPSTYARASSLSARPSSLVGSITTTAGTLSCRRGRRC 409          
BLAST of EY660170 vs. ExPASy Swiss-Prot
Match: PEL5_ARATH (Probable pectate lyase 5 OS=Arabidopsis thaliana GN=At1g67750 PE=2 SV=2)

HSP 1 Score: 171.014 bits (432), Expect = 7.990e-42
Identity = 80/126 (63.49%), Postives = 90/126 (71.43%), Query Frame = 3
Query:   12 LIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRYNAPLNAFAKEVTKRVDTAASQWKGWNWRSEGDLLLNGAYFTPXXXXXXXXXXXXXXXXXKSSSMVGSITSGAGALTCRKSRQC 389
            L+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTINSQGNR+ AP +   KEVTK  D   S+WK WNWRSEGDL LNGA+FTP                 + SS+V S+TS AGAL CRK  +C
Sbjct:  283 LVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTINSQGNRFLAPNDHVFKEVTKYEDAPRSKWKKWNWRSEGDLFLNGAFFTPSGGGASSSYAKASSLSARPSSLVASVTSNAGALFCRKGSRC 408          
BLAST of EY660170 vs. ExPASy Swiss-Prot
Match: PEL10_ARATH (Probable pectate lyase 10 OS=Arabidopsis thaliana GN=At3g24670 PE=2 SV=2)

HSP 1 Score: 169.859 bits (429), Expect = 1.780e-41
Identity = 80/126 (63.49%), Postives = 90/126 (71.43%), Query Frame = 3
Query:   12 LIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRYNAPLNAFAKEVTKRVDTAASQWKGWNWRSEGDLLLNGAYFTPXXXXXXXXXXXXXXXXXKSSSMVGSITSGAGALTCRKSRQC 389
            LIQRMPRCRHGYFHVVNNDYTHW MYAIGGSANPTINSQGNR+ AP N FAKEVTKRV +   +WK WNWRS+GDL+LNGAYFT                  K +S+V  +T  +GAL CR   +C
Sbjct:  315 LIQRMPRCRHGYFHVVNNDYTHWVMYAIGGSANPTINSQGNRFLAPGNPFAKEVTKRVGSWQGEWKQWNWRSQGDLMLNGAYFTKSGAAAPASYARASSLGAKPASVVSMLTYSSGALKCRIGMRC 440          
The following BLAST results are available for this feature:
BLAST of EY660170 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 38
Match NameE-valueIdentityDescription
PEL1_ARATH2.478e-5176.38Probable pectate lyase 1 OS=Arabidopsis thaliana G... [more]
PEL15_ARATH9.744e-4871.43Probable pectate lyase 15 OS=Arabidopsis thaliana ... [more]
PEL8_ARATH3.466e-4568.25Probable pectate lyase 8 OS=Arabidopsis thaliana G... [more]
PEL14_ARATH2.934e-4466.67Putative pectate lyase 14 OS=Arabidopsis thaliana ... [more]
PEL18_ARATH3.832e-4465.87Probable pectate lyase 18 OS=Arabidopsis thaliana ... [more]
PEL20_ARATH6.536e-4468.25Probable pectate lyase 20 OS=Arabidopsis thaliana ... [more]
PEL9_ARATH9.438e-4365.08Probable pectate lyase 9 OS=Arabidopsis thaliana G... [more]
PEL11_ARATH6.117e-4262.70Putative pectate lyase 11 OS=Arabidopsis thaliana ... [more]
PEL5_ARATH7.990e-4263.49Probable pectate lyase 5 OS=Arabidopsis thaliana G... [more]
PEL10_ARATH1.780e-4163.49Probable pectate lyase 10 OS=Arabidopsis thaliana ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-019-C09-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY660170 ID=EY660170; Name=EY660170; organism=Citrus sinensis; type=EST; length=888bp
CCACGCGTCCGCTCATTCAGAGAATGCCAAGGTGTAGACATGGTTATTTC
CATGTGGTGAACAATGACTACACTCACTGGGAAATGTATGCCATTGGTGG
AAGTGCAAACCCCACCATCAACAGCCAGGGAAACAGATACAATGCTCCAT
TGAATGCCTTCGCAAAGGAGGTAACAAAGAGGGTGGACACAGCTGCAAGC
CAGTGGAAGGGCTGGAACTGGAGATCTGAAGGAGACCTCTTGCTGAACGG
TGCCTACTTTACCCCATCCGGAGCAGGAGCCTCAGCTAGCTATGCTCGTG
CTTCAAGCTTGGGAGCCAAGTCTTCCTCCATGGTTGGATCCATTACTTCT
GGTGCTGGTGCTCTTACTTGCCGCAAGAGCCGTCAGTGCTCATAGTATTC
ATCATTAAATTGGCCGAAAAAAGAAATGGCCATCGAATTTCTGTTTTGTT
TTTCATTTTTCTTCTATATAGTATATCACCTATCCAATTTATCCACAATC
TGGTCATTGTTTCAATCTCTACCGTATATCTGCTTCACATATTTTGACAA
GTGTACATTATTGCACATGTCATTGTATTGCCTCACCCAGTTTGTTTATC
AGTTACTTGCTCAACCTCGGCCTGCTTCAACTGAAAAAACAAACATTTGC
ATTCCCAGAAGCAGGTGCGGAAGTGTTGTTCATTTTATTTTCCCTCTTTG
GCCTCTTTTTTCAGCCTCAATTCTCATTTCCTTCTAACTAGCACTTGCCT
ATTTGTGTCCAGTGTCAGTCAGCTGTCAACTGTCAATCTTGGTCTCTCTA
CATACTCTCCTTTTCATTTTTGGCTTTTGGGGTTATAAGGGTCGGAATGA
TTTTGTGCTTTTTTCTCCCCGCTCCCTTTGTGAGCTAA
back to top