EY660165

Overview
NameEY660165
Unique NameEY660165
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length936
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY660165 vs. ExPASy Swiss-Prot
Match: G3PA_PEA (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Pisum sativum GN=GAPA PE=2 SV=2)

HSP 1 Score: 436.032 bits (1120), Expect = 1.444e-121
Identity = 219/270 (81.11%), Postives = 241/270 (89.26%), Query Frame = 1
Query:   64 MASATLSVAKSALQGNGKGFSEFSGLRNSAS-LPFGRKSSDDFHSVIALQTSALGSSSSGYRKVAAQAK-LKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVXGVNADAYKPDEAIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTPHSYTGEQRLLDASPRGLQACKS 867
            MASAT SVAK A++ NGKGFSEFSGLRNS+  LPF RKSSDDFHS++  QT+A+GSS    + +  +AK LKVAINGFGRIGRNFLRCWHGRKDSPL+V+AINDTGGVKQASHLLKYDSTLGIF+ADVKPVGTDGISVDGKVI+VVS+RNP NLPW +LGIDLVIEGTGVFVDREGAG+HI AGAKKVLITAPGKGDIPTYV GVNADAY   + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTT HSYTG+QRLLDAS R L+  ++
Sbjct:    1 MASATFSVAKPAIKANGKGFSEFSGLRNSSRHLPFSRKSSDDFHSLVTFQTNAVGSSGGHKKSLVVEAKQLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKVIKVVSDRNPANLPWKELGIDLVIEGTGVFVDREGAGRHITAGAKKVLITAPGKGDIPTYVVGVNADAYTHADDIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARA 270          
BLAST of EY660165 vs. ExPASy Swiss-Prot
Match: G3PA_TOBAC (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GAPA PE=2 SV=1)

HSP 1 Score: 434.106 bits (1115), Expect = 5.489e-121
Identity = 214/258 (82.95%), Postives = 235/258 (91.09%), Query Frame = 1
Query:   94 SALQGNGKGFSEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSSSGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVXGVNADAYKPDEAIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTPHSYTGEQRLLDASPRGLQACKS 867
            S+LQ + KGFSEFSGLR S+++PFGRK++DD  SV+A QTS +G  +S  ++   +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+AINDTGGVKQASHLLKYDSTLGIF+ADVKPVGTDGISVDGKVIQVVS+RNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYV GVNAD Y PDE IISNASCTTNCLAPFVKVLDQKFGIIKGTMTT HSYTG+QRLLDAS R L+  ++
Sbjct:    2 SSLQVSNKGFSEFSGLRTSSAIPFGRKTNDDLLSVVAFQTSVIGGGNS--KRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKVIQVVSDRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADLYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARA 257          
BLAST of EY660165 vs. ExPASy Swiss-Prot
Match: G3PA_ARATH (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Arabidopsis thaliana GN=GAPA PE=1 SV=3)

HSP 1 Score: 412.535 bits (1059), Expect = 1.710e-114
Identity = 212/270 (78.52%), Postives = 234/270 (86.67%), Query Frame = 1
Query:   64 MASATLSVAKSALQGNGKGFSEFSGLRNS-ASLPFGRK-SSDDFHSVIALQTSALGSSSSGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVXGVNADAYKPDEAIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTPHSYTGEQRLLDASPRGLQACKS 867
            MAS T SV K        GF+EFSGLR+S ASLPFG+K SSD+F S+++ QTSA+GSS  GYRK   +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+++AINDTGGVKQASHLLKYDSTLGIF+ADVKP G   ISVDGK+IQVVSNRNP  LPW +LGID+VIEGTGVFVDREGAGKHI+AGAKKV+ITAPGKGDIPTYV GVNADAY  DE IISNASCTTNCLAPFVKVLDQKFGIIKGTMTT HSYTG+QRLLDAS R L+  ++
Sbjct:    1 MASVTFSVPK--------GFTEFSGLRSSSASLPFGKKLSSDEFVSIVSFQTSAMGSSG-GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARA 261          
BLAST of EY660165 vs. ExPASy Swiss-Prot
Match: G3PA_MAIZE (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Zea mays GN=GAPA PE=2 SV=1)

HSP 1 Score: 406.757 bits (1044), Expect = 9.384e-113
Identity = 211/270 (78.15%), Postives = 232/270 (85.93%), Query Frame = 1
Query:   64 MASATLSVAKSALQGNGKGFSEFSGLRNSASLPFGRKS-SDDFHSVIALQTSALGSSSSGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKD-SPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVXGVNADAYKPDEAIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTPHSYTGEQRLLDASPRGLQACKS 867
            MAS+ LS     LQ  G G SEFSGLR+SASLP  R + SDDF S ++ +T A+G+S  G R+   +AKLKVAINGFGRIGRNFLRCWHGR D SPL+V+AINDTGGVKQASHLLKYDSTLGIF+ADVKPVG + ISVDGKVI+VVS+RNP NLPWG+LGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYV GVNAD Y PDE IISNASCTTNCLAPFVKVLDQKFGIIKGTMTT HSYTG+QRLLDAS R L+  ++
Sbjct:    1 MASSMLSATTVPLQQGG-GLSEFSGLRSSASLPMRRNATSDDFMSAVSFRTHAVGTSG-GPRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDASPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARA 268          
BLAST of EY660165 vs. ExPASy Swiss-Prot
Match: G3PA_SPIOL (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Spinacia oleracea GN=GAPA PE=1 SV=2)

HSP 1 Score: 402.134 bits (1032), Expect = 2.311e-111
Identity = 203/270 (75.19%), Postives = 225/270 (83.33%), Query Frame = 1
Query:   64 MASATLSVAKSALQGNGKGFSEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSSSGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVXGVNADAYKPDEAIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTPHSYTGEQRLLDASPRGLQACKSTC 873
            MAS  LS+A  +L+   KGFSEFSGL  S SLPFGRK SDD  + ++ QT+A+G   S    V  +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VV INDTGGVKQASHLLKYDS LG F+ADVK  G   ISVDGKVI+VVS+RNPVNLPWGD+GIDLVIEGTGVFVDR+GAGKH+QAGAKKVLITAPGKGDIPTYV GVN + Y   + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTT HSYTG+QRLLDAS R L+  ++ C
Sbjct:    1 MASNMLSIANPSLRVYNKGFSEFSGLHTS-SLPFGRKGSDDLMAFVSFQTNAVGGKRSSQNGVV-EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAC 268          
BLAST of EY660165 vs. ExPASy Swiss-Prot
Match: G3PB_SPIOL (Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Spinacia oleracea GN=GAPB PE=1 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 4.242e-89
Identity = 170/250 (68.00%), Postives = 201/250 (80.40%), Query Frame = 1
Query:  124 SEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSSSGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYVXGVNADAYKPDEA-IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTPHSYTGEQRLLDASPRGLQACKS 867
            ++FSGLR+S S+ F R++S  FH VIA Q +   + ++  R     AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VV +ND+GGVK A+HLLKYDS LG F+ADVK +  +  S+DGK I+VVSNR+P+ LPW +LGID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYV GVN   Y  D A IISNASCTTNCLAPFVKVLD++ GI+KGTMTT HSYTG+QRLLDAS R L+  ++
Sbjct:   40 ADFSGLRSSNSVTFTREAS--FHDVIAAQLTTKPTGAAPVRGETV-AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARA 286          
BLAST of EY660165 vs. ExPASy Swiss-Prot
Match: G3PB_PEA (Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Pisum sativum GN=GAPB PE=2 SV=2)

HSP 1 Score: 323.168 bits (827), Expect = 1.365e-87
Identity = 164/250 (65.60%), Postives = 201/250 (80.40%), Query Frame = 1
Query:  127 EFSGLRNSASLPFGRKSSDD-FHSVIALQTSALGSSSSGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYVXGVNADAYKPDEA-IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTPHSYTGEQRLLDASPRGLQACKS 867
            EFSGL++++ + +   + D  F+ V+A Q ++  + S+  + V   AKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+ +ND+GGVK ASHLLKYDS LG F+A+VK +  + I+VDGK I+VVS+R+P+ LPW +LGID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYV GVN   Y  + A IISNASCTTNCLAPF KVLD++FGI+KGTMTT HSYTG+QRLLDAS R L+  ++
Sbjct:   39 EFSGLKSTSCISYVHSARDSSFYDVVAAQLTSKANGSTAVKGVTV-AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGTFKAEVKILNNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVIGVNEQDYGHEVADIISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARA 287          
BLAST of EY660165 vs. ExPASy Swiss-Prot
Match: G3PB_TOBAC (Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GAPB PE=2 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 3.040e-87
Identity = 168/250 (67.20%), Postives = 198/250 (79.20%), Query Frame = 1
Query:  124 SEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSSSGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYVXGVNADAYKPDEA-IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTPHSYTGEQRLLDASPRGLQACKS 867
            +EF+GLR+S  + F  K S  F  V++ Q +   + S+   K    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VV +ND+GGVK ASHLLKYDS LG F+ADVK V  + ISVDGK I+VVS+R+P+ LPW +LGID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYV GVN   Y  + A IISNASCTTNCLAPFVKV+D++ GI+KGTMTT HSYTG+QRLLDAS R L+  ++
Sbjct:    9 AEFAGLRSSGCVTFSNKESS-FFDVVSAQLTPKTTRSTPV-KGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADVKIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVADIISNASCTTNCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARA 256          
BLAST of EY660165 vs. ExPASy Swiss-Prot
Match: G3PB_ARATH (Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Arabidopsis thaliana GN=GAPB PE=1 SV=2)

HSP 1 Score: 318.546 bits (815), Expect = 3.361e-86
Identity = 169/250 (67.60%), Postives = 196/250 (78.40%), Query Frame = 1
Query:  124 SEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSSSGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYVXGVNADAYKPDEA-IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTPHSYTGEQRLLDASPRGLQACKS 867
            +EFSGLR S+    G ++S  F   +A Q      ++S   +    AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVV +ND+GGVK ASHLLKYDS LG F+A+VK V  + ISVDGK+I+VVSNR+P+ LPW +LGID+VIEGTGVFVD  GAGKHIQAGA KV+ITAP KG DIPTYV GVN   Y  D A IISNASCTTNCLAPF KVLD++FGI+KGTMTT HSYTG+QRLLDAS R L+  ++
Sbjct:   39 AEFSGLRMSS---IGGEAS--FFDAVAAQIIPKAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHLLKYDSMLGTFKAEVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGASKVIITAPAKGADIPTYVMGVNEQDYGHDVANIISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARA 283          
BLAST of EY660165 vs. ExPASy Swiss-Prot
Match: G3PA_CHLRE (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Chlamydomonas reinhardtii GN=GAPA PE=1 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 1.012e-82
Identity = 158/228 (69.30%), Postives = 184/228 (80.70%), Query Frame = 1
Query:  211 TSALGSSSSGYRKVAAQA--------KLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYVXGVNADAYKPDEAIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTPHSYTGEQRLLDASPRGLQACKS 867
            T +  SS SG R  AA+A        K++VAINGFGRIGRNFLRCWHGR+++ L+VVAIND+GGVKQASHLLKYDSTLG F ADVK V    ISVDGK I++VS+R+P+ LPW ++ IDLVIEGTGVF+D+ GAGKHIQAGA KVLITAP K  DIPT+V GVN   YK +  IISNASCTTNCLAPFVKVL+QKFGI+KGTMTT HSYTG+QRLLDAS R L+  ++
Sbjct:   11 TGSAVSSKSGVRAKAARAVVDVRAEKKIRVAINGFGRIGRNFLRCWHGRQNTLLDVVAINDSGGVKQASHLLKYDSTLGTFAADVKIVDDSHISVDGKQIKIVSSRDPLQLPWKEMNIDLVIEGTGVFIDKVGAGKHIQAGASKVLITAPAKDKDIPTFVVGVNEGDYKHEYPIISNASCTTNCLAPFVKVLEQKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARA 238          
The following BLAST results are available for this feature:
BLAST of EY660165 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 348
Match NameE-valueIdentityDescription
G3PA_PEA1.444e-12181.11Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_TOBAC5.489e-12182.95Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_ARATH1.710e-11478.52Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_MAIZE9.384e-11378.15Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_SPIOL2.311e-11175.19Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PB_SPIOL4.242e-8968.00Glyceraldehyde-3-phosphate dehydrogenase B, chloro... [more]
G3PB_PEA1.365e-8765.60Glyceraldehyde-3-phosphate dehydrogenase B, chloro... [more]
G3PB_TOBAC3.040e-8767.20Glyceraldehyde-3-phosphate dehydrogenase B, chloro... [more]
G3PB_ARATH3.361e-8667.60Glyceraldehyde-3-phosphate dehydrogenase B, chloro... [more]
G3PA_CHLRE1.012e-8269.30Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-019-C04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY660165 ID=EY660165; Name=EY660165; organism=Citrus sinensis; type=EST; length=936bp
CCACGCGTCCGAGCTTAGCGACCACTGCTTGCTCTTGCTTGCATCATCCA
GCAAATACCTATCATGGCTTCGGCCACTCTCTCTGTAGCCAAATCAGCTC
TTCAGGGAAATGGTAAGGGATTCTCAGAATTCTCAGGTCTACGCAACTCT
GCAAGCCTTCCTTTTGGCAGGAAATCTTCTGATGACTTCCATTCAGTCAT
TGCTCTCCAGACCTCTGCTTTAGGAAGCAGCAGCAGCGGGTACAGGAAGG
TTGCTGCTCAGGCAAAGCTGAAGGTTGCAATCAATGGGTTTGGTAGAATT
GGTAGGAACTTCTTGAGGTGCTGGCACGGCCGCAAGGACTCTCCACTTGA
AGTCGTTGCCATCAATGACACCGGAGGTGTCAAGCAGGCCTCTCACCTCC
TCAAGTACGACTCCACCCTTGGCATCTTTGAAGCCGATGTTAAACCAGTT
GGTACTGATGGCATCTCTGTTGATGGCAAGGTCATCCAGGTTGTTTCTAA
CCGCAACCCCGTCAATCTCCCCTGGGGGGACTTGGGCATCGACCTTGTGA
TTGAAGGGACAGGAGTGTTTGTAGACAGAGAGGGTGCGGGCAAGCACATT
CAGGCTGGTGCCAAGAAAGTACTTATTACAGCCCCCGGCAAGGGTGACAT
CCCAACCTACGTTGNTGGTGTCAATGCGGATGCTTACAAGCCAGATGAGG
CCATCATCAGCAATGCTTCTTGCACAACCAACTGCCTTGCCCCATTCGTC
AAGGTTCTTGACCAGAAGTTTGGCATTATCAAGGGGACCATGACCACCCC
ACACTCGTACACTGGGGAACAAAGGCTACTCGATGCTAGCCCACGTGGAC
TTCAGGCGTGCAAGAGCACCTGCACTCTAAATTGTGCCCACATCAACCGG
TGGCGGAAAAGGTGGGTGCCTTGGGCTTCCAGACTC
back to top